DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2015-27 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264938X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-28 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264934X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-29 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264917X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-30 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264930X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-31 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264925X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-32 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264935X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-33 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264918X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-34 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264937X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-35 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264931X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-36 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264922X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-37 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264927X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-38 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264923X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-39 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264919X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-40 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264926X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-41 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264936X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-42 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264932X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-43 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264928X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-44 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264924X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-45 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264920X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-46 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264933X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-47 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264939X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-48 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264929X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation zhang-2015-49 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. DIP original experiment: DIP-264921X PLoS biology 2015 IMEx GSK3β-Dzip1-Rab8 cascade regulates ciliogenesis after mitosis. Zhang B., Zhang T., Wang G., Wang G., Chi W., Jiang Q., Zhang C. Only protein-protein interactions imex curation dzip1_mouse Zinc finger protein DZIP1 DAZ-interacting protein 1 homolog Dzip1 Kiaa0996 protein protein mouse Mus musculus Mouse MPFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRHTEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSKDYEMQKSKEEDFLKLFDRWKEEEKEKLLEEMEKVKGMFMREFKELTSKNSALEYQLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQASKWTDRFQVLNEEHSKEKGQLLSHIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQIREFASKPYSSISELKGTPLTRQTLEPKSAAPTTPMTASATQNLDGASSLTMVHEQVFSSHILEPIEELSSEEEKGRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGANIQGIPCEILNRSLKAMQVARHDLAKQMPDIQQIRESLEHQLICKMEEKVSLSSDRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPKLKKNTKESHFLRRFPSTKTPPFSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTGTSITIQTDTVETMALPQGSGNKAVPGMNPADTVIKKESLQELKCTDADDEDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRAWGPVNPREFKEEGLHENEPSTLKSNLVTVTDWSDVLDV mint May participate in spermatogenesis via its interaction with DAZ gdib_human Rab GDP dissociation inhibitor beta Guanosine diphosphate dissociation inhibitor 2 GDI2 RABGDIB protein protein human Homo sapiens Human MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED p49841-2 Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B GSK-3beta2 neuron-specific protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST May play a specific role in axon growth and neurite outgrowth. Reduced binding to AXIN1, reduced ability to phosphorylate MAPT/TAU. rab8a_mouse Ras-related protein Rab-8A Rab8a Mel Rab8 Oncogene c-mel protein protein mouse Mus musculus Mouse MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL q8bmd2-1 Zinc finger protein DZIP1 Dzip1 Kiaa0996 DAZ-interacting protein 1 homolog protein protein mouse Mus musculus Mouse MPFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRHTEDSHLEYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSKDYEMQKSKEEDFLKLFDRWKEEEKEKLLEEMEKVKGMFMREFKELTSKNSALEYQLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQASKWTDRFQVLNEEHSKEKGQLLSHIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQIREFASKPYSSISELKGTPLTRQTLEPKSAAPTTPMTASATQNLDGASSLTMVHEQVFSSHILEPIEELSSEEEKGRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGANIQGIPCEILNRSLKAMQVARHDLAKQMPDIQQIRESLEHQLICKMEEKVSLSSDRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPKLKKNTKESHFLRRFPSTKTPPFSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTGTSITIQTDTVETMALPQGSGNKAVPGMNPADTVIKKESLQELKCTDADDEDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRAWGPVNPREFKEEGLHENEPSTLKSNLVTVTDWSDVLDV rab8a_canlf Ras-related protein Rab-8A RAB8A MEL RAB8 Oncogene c-mel protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL mint May be involved in vesicular trafficking and neurotransmitter release gdib_mouse Rab GDP dissociation inhibitor beta Gdi2 Gdi3 GDI-3 Guanosine diphosphate dissociation inhibitor 2 protein protein mouse Mus musculus Mouse MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED dzip1_human Zinc finger protein DZIP1 DAZ-interacting protein 1/2 DZIP1 DZIP DZIP2 KIAA0996 protein protein human Homo sapiens Human MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPMVHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGPLPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVPEMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKGEGLQENESSTLKSSLVTVTDWSDTSDV gsk3b_mouse Glycogen synthase kinase-3 beta Gsk3b Serine/threonine-protein kinase GSK3B protein protein mouse Mus musculus Mouse MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST rab10_mouse Ras-related protein Rab-10 Rab10 protein protein mouse Mus musculus Mouse MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL rab3i_human Rab-3A-interacting protein Rabin-3 SSX2-interacting protein RAB3IP RABIN8 protein protein human Homo sapiens Human MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL gdi2-dzip1-1 3277890 N/A 3277913 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277914 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false gsk3b-12 3277891 N/A 3277915 putative self putative self unspecified role unspecified role P49841-2:p.Lys85Arg K85R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false dzip1-rab8a-1 3277892 N/A 3277913 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3277916 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false dzip1-gdi2-1 3277893 N/A 3277917 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-600 Region 1-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 430-852 Region 430-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3277914 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false gdi2-rab8a-1 3277894 N/A 3277916 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277914 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false dzip1-gsk3b-1 3277895 N/A 3277917 enzyme target enzyme target substrate substrate unspecified role unspecified role Q8BMD2-1:p.Ser520Ala S520A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 1-378 Region 1-378 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 594-852 Region 594-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 373-600 Region 373-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277915 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false rab8a-dzip1-1 3277896 N/A 3277913 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277916 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false dzip1-gsk3b-2 3277897 N/A 3277917 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 373-600 Region 373-600 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277915 enzyme enzyme unspecified role unspecified role P49841-2:p.Lys85Arg K85R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false rab8a-gdi2-1 3277898 N/A 3277918 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3277914 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false dzip1-gdi2-2 3277899 N/A 3277913 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3277919 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false gsk3b-dzip1-1 3277900 N/A 3277920 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3277915 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false rab8a-gdi2-2 3277901 N/A 3277918 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3277914 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false rab8a-dzip1-2 3277902 N/A 3277918 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P61007:p.Gln67Leu Q67L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3277917 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false dzip1-gsk3b-3 3277903 N/A 3277913 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3277921 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false rab8a-dzip1-3 3277904 N/A 3277918 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P61007:p.Thr22Asn T22N mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3277917 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-600 Region 1-600 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 430-852 Region 430-852 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false gdi2-dzip1-2 3277905 N/A 3277913 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277916 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277914 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false gsk3b-dzip1-2 3277906 N/A 3277917 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3277915 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false gdi2-dzip1-3 3277907 N/A 3277916 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277917 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 430-600 Region 430-600 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277914 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false rab10-dzip1-1 3277908 N/A 3277922 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3277917 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false gdi2-dzip1-4 3277909 N/A 3277923 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3277917 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3277914 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false rab3ip-rab8a-4 3277910 N/A 3277918 unspecified role unspecified role prey prey P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3277924 unspecified role unspecified role bait bait Region 101-316 Region 101-316 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false GFP-tag GFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false gdi2-dzip1-5 3277911 N/A 3277913 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3277919 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false dzip1-rab8a-2 3277912 N/A 3277918 unspecified role unspecified role prey prey P61007:p.Thr22Asn T22N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3277917 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false