DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kfinger-2015-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265399X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation kfinger-2015-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265397X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation kfinger-2015-3 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265400X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation kfinger-2015-4 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265398X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation kfinger-2015-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265402X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation kfinger-2015-6 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. DIP original experiment: DIP-265401X Structure (London, England : 1993) 2015 IMEx Solution structure of the Atg1 complex: implications for the architecture of the phagophore assembly site. Köfinger J., Ragusa MJ., Lee IH., Hummer G., Hurley JH. Only protein-protein interactions imex curation q6cx74_klula KLLA0_A10637g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MESPVLLVKNANAATNASNLGLLGQKQNSYTVDENTWFLNNISFIFEDDDPSQHDEDQLDYENVIIIDSEPSGTVNNVEMLSERWQLLAFDQNPRDNCISLTVMNELSADLGQNTDISGLDNLSKLYHERNAQIRKLLDSIAP atg29_klula Autophagy-related protein 29 ATG29 KLLA0C09933g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MNNDNTKVYVRVAGKRPENFVETKPFIWDSRRDKILWTKISKIDSLEDMDWQELGADLGAPEPFLKKRSYTLFQNQLKVLSNQIDVTSNTRSSSESRNSVDNNILQNLQASRIMNHKLDKTDNLANNQESSSELSNLSVSKSALEDALMDCLQL atg17_klula Autophagy-related protein 17 ATG17 KLLA0D02750g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSDAATTIPSDEIDKLWNKARNQLVEAQVECEESLKILSKVRTEMDSSQKSRFKLKFILNCLVNQVEFFKNIMLEKCISTELIDNEWSKLVLVEIVNDVSYWQNEITTKMKILQGTKYDLTDDHSSLSDFICMDHVDILQQKIDEIPIIKQQVTNIRQHYKSIKDRIENQLVAVKLKKLRTYFDSHFSRDSKNNLFKLLESDYVTELNEFENELADFLRSITDHFDKCTILKEQQIPLPDLKELFQIVKKDDTQLENIRELVFETGLEVKAFSKKVNETISEIMDKIGGFHLLASKIVTELEKCEEYLSIFQKIANLVFVYKESCIKKIEQVQQLCEFYDKFKLGYKNLLRERDRRKATALQMEKILKECQEKLQALSDADLDQRQQFLLENGDYLPENIWPGYIDDMESMYSFEYSIHNVPN atg13_klula Autophagy-related protein 13 ATG13 KLLA0B03432g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSEGEVQVIELINNFFLKSALLLEQSKVAHNFDTEEALRDGNHLFNIETRGDPLLEAQIQPWITFDGVKTMPPLVIETYLDLRALQPNHMVYLHDADGNPWMVCKGGKKTEIVLERWLVELDKQTIDDSIDSNDPENLHKQLVLLFRYLYTLTQLLPANDIITKPHNSQQPALINVQTRLLDGSKPILSKGRVGLSKPIIASYSNTMNETNIASHLEQRKITPIKTTFGSLRITVSYRKDVDFYVIDSDDLQKRYMTPSLSNETTTVPDRRASSNCSRSMSVSPKTNTINATLFPLEGSSARRQSISSKLQPFKVGSVGSGSFVQSGSAQSTTSLVPSLSRNVSSSSVVAALKVQRGSAGSTIVNGDVPPELSSVGSGSKYSSSFGRIRRHSSIRRSESFDRTAKPRKSTENPPEDLLEFVKLLEDKKELNMKPNTILPQQDISNSLMRFQSMKSNNDALSDNLSMSMSIDQPNVRFGSNSHSPIPSFSPNYGSIPSRLSQGSRNNSNAELITSRKSSLDRHKHNLLSRTGSNVDINRRGSVGTMETTNEDSKEDEQSHMKGMHFSNEATINKDDDEDEMLMKRSFNAGTSTTEQVMGSPRSIRSISVSSYPRNQLPLKHLNLSHPTTSATTTHAKFHKSEMSPDPLHTEGAQPHTSSQHHNSSQKNDEDDDLLFVMSDMNLTN atg1_klula Serine/threonine-protein kinase ATG1 ATG1 Autophagy-related protein 1 KLLA0C17160g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSSESHDKVVAKAIRLPTENYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGFTDFFNNEVVTEDLTRYEQSYEPDLESKSKDVAESNMFVSEYLVKPLKQQESAHIPPTQTDENTSVQTGVRRTSGKERLATNHPPHQQIHPEDNSQNPEQSYQSASQKRLKSSYNDLILEKEYVVVEKKTVEVNSLADDFANNGPITNNQGAQVIKPLRYRTSSSSDASGGRRASLVERRLSISSLSPSNALSKALGLASVRLFGYQHNTKATSSPPQQTLLNPQIFQELTENAVLRADHKLNPFSEQMLDSNITPAVESLAAKAFVMYSFAEMKFSQILPTPPSSTDYDPLSDKRLSNGSCAIEDEEDLDQGRPPSNQTLTSATTKISSATNVDTQIPAPELKKLCTESLLLYLKALTILAASMKLTSKWWYENESKNCTLKLNILVQWIRDRFNECLDKAEFLRLKLHAINTSPNSQWSDDDPVIFVEKLIYDRALDISRNAARMEMESGNYNTCELAYATSLWMLEILLDENFQFNEVYDDEYASNITSLDESDKEMIKKYISSIANRLKALKSKMV atg1-atg13-5 3277528 N/A 3277534 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277535 unspecified role unspecified role unspecified role unspecified role Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277536 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277537 unspecified role unspecified role unspecified role unspecified role Region 350-525 Region 350-525 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277538 unspecified role unspecified role unspecified role unspecified role Region 562-831 Region 562-831 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false atg1-atg13-6 3277529 N/A 3277537 unspecified role unspecified role unspecified role unspecified role Region 400-475 Region 400-475 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277538 unspecified role unspecified role unspecified role unspecified role Region 562-831 Region 562-831 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg1-atg13-7 3277530 N/A 3277534 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277535 unspecified role unspecified role unspecified role unspecified role Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277536 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277537 unspecified role unspecified role unspecified role unspecified role Region 350-525 Region 350-525 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277538 unspecified role unspecified role unspecified role unspecified role Region 562-831 Region 562-831 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false atg1-atg13-8 3277531 N/A 3277537 unspecified role unspecified role unspecified role unspecified role Region 400-475 Region 400-475 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277538 unspecified role unspecified role unspecified role unspecified role Region 562-831 Region 562-831 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false atg17-atg29-4 3277532 N/A 3277534 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277535 unspecified role unspecified role unspecified role unspecified role Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277536 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false atg17-atg29-5 3277533 N/A 3277534 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277535 unspecified role unspecified role unspecified role unspecified role Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277536 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false