DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ryu-2015-1 in vitro In vitro force spectroscopy force spectroscopy intermolecular force predetermined predetermined participant predetermined Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. DIP original experiment: DIP-265394X Science (New York, N.Y.) 2015 IMEx Spring-loaded unraveling of a single SNARE complex by NSF in one round of ATP turnover. Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. Only protein-protein interactions imex curation ryu-2015-2 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. DIP original experiment: DIP-265396X Science (New York, N.Y.) 2015 IMEx Spring-loaded unraveling of a single SNARE complex by NSF in one round of ATP turnover. Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. Only protein-protein interactions imex curation ryu-2015-3 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. DIP original experiment: DIP-265395X Science (New York, N.Y.) 2015 IMEx Spring-loaded unraveling of a single SNARE complex by NSF in one round of ATP turnover. Ryu JK., Min D., Rah SH., Kim SJ., Park Y., Kim H., Hyeon C., Kim HM., Jahn R., Yoon TY. Only protein-protein interactions imex curation nsf_crigr Vesicle-fusing ATPase NSF N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD snaa_bovin Alpha-soluble NSF attachment protein NAPA SNAPA N-ethylmaleimide-sensitive factor attachment protein alpha protein protein bovin Bos taurus (Bovine) Bovine MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGSAFCQAAHVHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKRIKKLLEAHEEQNVDSYTEAVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR p60881-2 Synaptosomal-associated protein 25 Snap25 Snap Super protein Synaptosomal-associated 25 kDa protein SNAP-25a protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST napa-nsf-5 3277506 N/A 3277509 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3277510 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false vamp2-snap25-2 3277507 N/A 3277511 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Cy5-label Cy5-label cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277512 unspecified role unspecified role fluorescence donor fluorescence donor Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Cy3-label Cy3-label cy3 label cy3 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false vamp2-snap25-3 3277508 N/A 3277511 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Cy5-label Cy5-label cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3277512 unspecified role unspecified role fluorescence donor fluorescence donor Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Cy3-label Cy3-label cy3 label cy3 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false