DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mateja-2015-1 ecolx Escherichia coli density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265368X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-2 ecolx Escherichia coli density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265379X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265373X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265383X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265369X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-6 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265374X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265380X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265375X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-9 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265370X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265384X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265371X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-12 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265381X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-13 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265376X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-14 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265377X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-15 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265385X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-16 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265372X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-17 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265378X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-18 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265382X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation mateja-2015-19 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. DIP original experiment: DIP-265386X Science (New York, N.Y.) 2015 IMEx Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo. Mateja A., Paduch M., Chang HY., Szydlowska A., Kossiakoff AA., Hegde RS., Keenan RJ. Only protein-protein interactions imex curation get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 pep12_yeast Syntaxin PEP12 PEP12 Vacuolar protein sorting-associated protein 6 Vacuolar protein-targeting protein 13 Carboxypeptidase Y-deficient protein 12 VPS6 VPT13 OR26.29 YOR036W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAMRYQKRTSRWRVYLLIVLLVMLLFIFLIMKL D9F5711339DA1CDA sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 mdy2_yeast Ubiquitin-like protein MDY2 MDY2 TMA24 Mating-deficient protein 2 Translation machinery-associated protein 24 GET5 Golgi to ER traffic protein 5 YOL111C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSASGPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQNRAKKLKLHQDQQGQDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNPTISKEPEAEKSTNSPAPAPPQELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK CE6FC4282E0E472C get4_yeast Golgi to ER traffic protein 4 GET4 O3580 YOR164C Guided entry of tail-anchored proteins 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFLQDMMSGFLGGSK 98AFFDB4EA51B40F nyv1_yeast Vacuolar v-SNARE NYV1 NYV1 Synaptobrevin NYV1 New v-SNARE 1 MAM2 YLR093C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW 494B587CF0F85997 get3-4 3276461 N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-pep12-1 3276462 N/A 3276481 unspecified role unspecified role unspecified role unspecified role Region 262-288 Region 262-288 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-5 3276463 N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sec22-get3-1 3276464 N/A 3276482 unspecified role unspecified role bait bait Region 184-214 Region 184-214 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false get4-get5-3 3276465 N/A 3276483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276484 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-6 3276466 N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get5-get4-1 3276467 N/A 3276483 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3276484 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false get3-pep12-2 3276468 N/A 3276481 unspecified role unspecified role unspecified role unspecified role Region 262-288 Region 262-288 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get4-get5-4 3276469 N/A 3276483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276484 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-nyv1-1 3276470 N/A 3276485 unspecified role unspecified role unspecified role unspecified role Region 225-251 Region 225-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-get4-3 3276471 N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276484 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false get3-sec22-2 3276472 N/A 3276482 unspecified role unspecified role unspecified role unspecified role Region 184-214 Region 184-214 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-pep12-3 3276473 N/A 3276481 unspecified role unspecified role unspecified role unspecified role Region 262-288 Region 262-288 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pep12-get3-1 3276474 N/A 3276481 unspecified role unspecified role bait bait Region 262-288 Region 262-288 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false get3-nyv1-2 3276475 N/A 3276485 unspecified role unspecified role unspecified role unspecified role Region 225-251 Region 225-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-get4-4 3276476 N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3276484 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false get3-pep12-4 3276477 N/A 3276481 unspecified role unspecified role unspecified role unspecified role Region 262-288 Region 262-288 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-sec22-3 3276478 N/A 3276482 unspecified role unspecified role unspecified role unspecified role Region 184-214 Region 184-214 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nyv1-get3-1 3276479 N/A 3276485 unspecified role unspecified role bait bait Region 225-251 Region 225-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3276480 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false