DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kakugawa-2015-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265468X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation kakugawa-2015-2 in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265470X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation kakugawa-2015-3 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265473X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation kakugawa-2015-4 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265471X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation kakugawa-2015-5 in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265469X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation kakugawa-2015-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. DIP original experiment: DIP-265472X Nature 2015 IMEx Notum deacylates Wnt proteins to suppress signalling activity. Kakugawa S., Langton PF., Zebisch M., Howell SA., Chang TH., Liu Y., Feizi T., Bineva G., O'Reilly N., Snijders AP., Jones EY., Vincent JP. Only protein-protein interactions imex curation p51654-1 Glypican-3 GPC3 OCI5 GTR2-2 Intestinal protein OCI-5 MXR7 protein protein human Homo sapiens Human MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH notum_human Palmitoleoyl-protein carboxylesterase NOTUM NOTUM hNOTUM OK/SW-CL.30 protein protein human Homo sapiens Human MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS wnt3a_human Protein Wnt-3a WNT3A protein protein human Homo sapiens Human MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK notum_drome Palmitoleoyl-protein carboxylesterase NOTUM Notum wf CG13076 Protein Notum Protein wingful dNOTUM protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVEQIDKMAAKAGEATNKWIKPQQPLLTLLLLLATFSQLPAVCSSSILDAASLQEKDPLRDTSMNMIQRNYMVMHSASGSGDHSRSLKRANLANTSITCNDGSHAGFYLRKHPSSKKWIVLLEGGWHCFDVRSCRSRWMRLRHLMTSSQWPETRDVGGILSPHPEENPYWHNANHVLIPYCSSDSWSGTRTEPDTSDRENSWRFMGALILRQVIAELIPVGLGRVPGGELMLVGSSAGGMGVMLNLDRIRDFLVNEKKLQITVRGVSDSGWFLDREPYTPAAVASNEAVRQGWKLWQGLLPEECTKSYPTEPWRCYYGYRLYPTLKTPLFVFQWLFDEAQMRVDNVGAPVTPQQWNYIHEMGGALRSSLDNVSAVFAPSCIGHGVLFKRDWVNIKIDDISLPSALRCWEHSTRSRRHDKLKRSTEPSTAVSHPEHANNQRHQRHRQRLQRQKHNNVAQSGGQQRKHNHLSKEEREERKRLRQEQRQRRKQRRRQQQQKKANGGQEHRNKKDNSPKSSNGNDQRKQRRRQQLTAEERQEQRKRRRKAQQQQMKMQREQPAAGVFLEASAPQKTRSSNNASAGTKSKKRHRVPRVPEKCGLRLLERCSWPQCNHSCPTLTNPMTGEEMRFLELLTAFGLDIEAVAAALGVDMHTLNNMERTELVNMLTQQAN wnt3a_mouse Protein Wnt-3a Wnt3a Wnt-3a protein protein mouse Mus musculus Mouse MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK gpc3-notum-1 3276307 N/A 3276313 unspecified role unspecified role bait bait Region 31-538 Region 31-538 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3276314 unspecified role unspecified role prey prey Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false notum-wnt3a-1 3276308 N/A 3276315 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 205-215 Region 205-215 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3276314 enzyme enzyme unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6P988:p.Ser232Ala S232A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human deacetylation deacetylation reaction deacetylation false false false notum-1 3276309 N/A 3276314 unspecified role unspecified role unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false notum-2 3276310 N/A 3276316 unspecified role unspecified role unspecified role unspecified role Region 82-415/598-617 Region 82-415/598-617 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false notum-wnt3a-2 3276311 N/A 3276317 enzyme target enzyme target substrate substrate unspecified role unspecified role mouse Mus musculus Mouse N/A 3276314 enzyme enzyme unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human deacetylation deacetylation reaction deacetylation false false false notum-wnt7a-1 3276312 N/A 3276318 unspecified role unspecified role unspecified role unspecified role Region 202-209 Region 202-209 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3276314 unspecified role unspecified role unspecified role unspecified role Region 81-451 Region 81-451 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false