DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zorzatto-2015-1 tobac Nicotiana tabacum (Common tobacco) Common tobacco anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265487X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265482X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-3 tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265485X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265483X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-5 tobac Nicotiana tabacum (Common tobacco) Common tobacco anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265488X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-6 tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265486X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation zorzatto-2015-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. DIP original experiment: DIP-265484X Nature 2015 IMEx NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism. Zorzatto C., Machado JP., Lopes KV., Nascimento KJ., Pereira WA., Brustolini OJ., Reis PA., Calil IP., Deguchi M., Sachetto-Martins G., Gouveia BC., Loriato VA., Silva MA., Silva FF., Santos AA., Chory J., Fontes EP. Only protein-protein interactions imex curation limyb_arath L10-interacting MYB domain-containing protein LIMYB MJJ3.22 At5g05800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPKAVWEPEYHRVFVDLCVEQTMLGNKPGTHFSKEGWRNILISFQEQTGAMYDRMQLKNHWDTMSRQWKIWRRLVETSFMNWNPESNRFRATDDDWANYLQENPDAGQYRLSVPHDLKKLEILFAGCNVEVKNDEVSGVRKRRRSCYEEEDEDNQSMCSSSNPQTKGYWSPSTHKLFLDLLVQETLKGNRPDTHFNKEGWKTILGTINENTGLGYTRPQLKNHWDCTRKAWKIWCQLVGASSMKWDPESRSFGATEEEWRIYIRENPRAGQFRHKEVPHADQLAIIFNGVIEPGETYTPPSRSRKKLLHNRSESPQWRDTTPLSKMHVDEAETSRQNGCYAESQEDRIDSENAQPLDDMKLMNDVMLQESPVFVEIESAKPMYSIGECIKSLNAIEEVEQGSELYMFALDLFLKREYREIFLELKKPSLRIAWLQRLQSTSFPIPTTT rl101_arath 60S ribosomal protein L10-1 Ribosomal protein RPL10A SAC52 Suppressor of ACAULIS 52 F14L17.9 RPL10A At1g14320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGVNAKFLSCHGPLANRQPGSAFLPAHY nik1_arath Protein NSP-INTERACTING KINASE 1 NIK1 LRR receptor-like serine/threonine-protein kinase NIK1 F1N13_140 At5g16000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESTIVMMMMITRSFFCFLGFLCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNIKGKIPAEIGRLTRLETLDLSDNFFHGEIPFSVGYLQSLQYLRLNNNSLSGVFPLSLSNMTQLAFLDLSYNNLSGPVPRFAAKTFSIVGNPLICPTGTEPDCNGTTLIPMSMNLNQTGVPLYAGGSRNHKMAIAVGSSVGTVSLIFIAVGLFLWWRQRHNQNTFFDVKDGNHHEEVSLGNLRRFGFRELQIATNNFSSKNLLGKGGYGNVYKGILGDSTVVAVKRLKDGGALGGEIQFQTEVEMISLAVHRNLLRLYGFCITQTEKLLVYPYMSNGSVASRMKAKPVLDWSIRKRIAIGAARGLVYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVKKIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEGDGLAEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR rpl10a-limyb-1 3276088 N/A 3276095 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco N/A 3276096 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association false false false rpl10a-limyb-2 3276089 N/A 3276095 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276096 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false limyb-rpl10a-1 3276090 N/A 3276095 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco N/A 3276096 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association false false false rpl10a-limyb-3 3276091 N/A 3276095 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276096 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false limyb-rpl10a-2 3276092 N/A 3276095 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco N/A 3276096 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association false false false limyb-rpl10a-3 3276093 N/A 3276095 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco N/A 3276096 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association false false false nik1-rpl10a-1 3276094 N/A 3276097 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3276096 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false