DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nguyen-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. DIP original experiment: DIP-264799X Structure (London, England : 1993) 2015 IMEx Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex. Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. Only protein-protein interactions imex curation nguyen-2015-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. DIP original experiment: DIP-264802X Structure (London, England : 1993) 2015 IMEx Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex. Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. Only protein-protein interactions imex curation nguyen-2015-3 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. DIP original experiment: DIP-264801X Structure (London, England : 1993) 2015 IMEx Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex. Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. Only protein-protein interactions imex curation nguyen-2015-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. DIP original experiment: DIP-264800X Structure (London, England : 1993) 2015 IMEx Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex. Nguyen HC., Yang H., Fribourgh JL., Wolfe LS., Xiong Y. Only protein-protein interactions imex curation cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA q15369-1 Elongin-C ELOC TCEB1 Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD cul2-elob-1 3275146 N/A 3275150 unspecified role unspecified role unspecified role unspecified role Region 1-163 Region 1-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275151 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275152 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3275153 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false vhl-cul2-9 3275147 N/A 3275150 unspecified role unspecified role prey prey Region 1-277 Region 1-277 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275151 unspecified role unspecified role prey prey Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275152 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3275153 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false cul2-elob-2 3275148 N/A 3275150 unspecified role unspecified role unspecified role unspecified role Region 1-163 Region 1-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275151 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275152 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3275153 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cul2-elob-3 3275149 N/A 3275150 unspecified role unspecified role unspecified role unspecified role Region 1-163 Region 1-163 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275151 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3275152 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3275153 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false