IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rhodes-2015-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. Variant 2 corresponds to O00481-2 as shown by Blat of primers. dar32@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions rhodes-2015-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions rhodes-2015-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. dar32@cam.ac.uk Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions rhodes-2015-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J., Rhodes DA., Chen HC., Price AJ., Keeble AH., Davey MS., James LC., Eberl M., Trowsdale J. The BTN3A1 cytoplasmic tail mapping has been partially taken from Supp Table 1 3A1.GB.F primer. dar32@cam.ac.uk a "human cDNA library" Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions pepl_human Periplakin PPL KIAA0568 195 kDa cornified envelope precursor protein 190 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRGYSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEVLKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRIEPEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQLLDLAQEKVDVANRLEKSLQQSWELLATHENHLNQDDTVPESSRVLDSKGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQEAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQKNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEAALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELDEETERRRQLENEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEEQHKNQLLQEELEALQLQLRALEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKVEKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTRLIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQKKQVDLERERASQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELERQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLAALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRLEARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDSRLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSGQK bt3a1_human Butyrophilin subfamily 3 member A1 BTN3A1 BTF5 protein protein human Homo sapiens Human MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALTICPA o00481-2 Butyrophilin subfamily 3 member A1 BTN3A1 BTF5 protein protein human Homo sapiens Human MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPGEEMLQMRLHFVK No experimental confirmation available. (2e)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (2E)-4-hydroxy-3-methylbut-2-en-1-yl diphosphate (2E)-4-hydroxy-3-methylbut-2-en-1-yl pyrophosphate (E)-4-hydroxy-3-methyl-2-buten-1-yl diphosphate (E)-4-hydroxy-3-methyl-2-buten-1-yl pyrophosphate (E)-4-Hydroxy-3-methyl-but-2-enyl diphosphate (E)-4-Hydroxy-3-methylbut-2-en-1-yl diphosphate (E)-4-Hydroxy-3-methylbut-2-enyl diphosphate (E)-4-hydroxy-3-methylbut-2-enyl pyrophosphate 1-Hydroxy-2-methyl-2-butenyl 4-diphosphate 1-hydroxy-2-methylbut-2(E)-en-4-yl diphosphate 1-hydroxy-2-methylbut-2(E)-en-4-yl pyrophosphate HMBPP (2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) isopentenyl diphosphate isopentenyl diphosphate 3-Methyl-3-butenyl pyrophosphate 3-methylbut-3-en-1-yl trihydrogen diphosphate 3-methylbut-3-enyl phosphono hydrogen phosphate delta-3-Isopentenyl pyrophosphate delta3-isopentenyl diphosphate delta3-Isopentenyl diphosphate delta3-Methyl-3-butenyl diphosphate Diphosphoric acid mono(3-methyl-3-butenyl) ester IPP IPPP Isopentenyl diphosphate Isopentenyl pyrophosphate Mono(3-methyl-3-butenyl) diphosphate 3-methylbut-3-en-1-yl trihydrogen diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) bt1a1_human Butyrophilin subfamily 1 member A1 BTN1A1 BTN protein protein human Homo sapiens Human MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGRETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPRRVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP btn3a1-ppl-2 2964105 N/A 2964109 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964110 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1 A/C-3 btn3a1-ppl-3 2964105 N/A 2964109 unspecified role unspecified role prey prey region(BamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964110 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1 A/C-2 btn3a1-ppl-4 2964105 N/A 2964109 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964110 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1 A/C-1 btn3a1-ppl-7 2964105 N/A 2964109 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964111 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1C-1 btn3a1-ppl-8 2964105 N/A 2964109 unspecified role unspecified role prey prey region(BamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964111 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1C-2 btn3a1-ppl-9 2964105 N/A 2964109 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 2964111 unspecified role unspecified role bait bait B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1C-3 (2e)_4_hydroxy_3_methylbut_2_en_1_yl diphosphate-btn3a1-1 2964106 N/A 2964112 unspecified role unspecified role neutral component neutral component N/A 2964110 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2964106 1C btn3a1-isopentenyl diphosphate-1 2964106 N/A 2964113 unspecified role unspecified role neutral component neutral component N/A 2964110 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false B30.2_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2964106 1D btn3a1-ppl-6 2964106 N/A 2964109 unspecified role unspecified role neutral component neutral component region(bamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2964110 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false cytoplasmic_tail_region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2964176 2964172 physical association physical association false false false 2964106 2B, Supp 1B btn3a1-ppl-10 2964106 N/A 2964109 unspecified role unspecified role neutral component neutral component region(bamH1) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2964111 unspecified role unspecified role neutral component neutral component possible_his_tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2964184 2964180 physical association physical association false false false 2964106 Supp 1E btn3a1-ppl-5 2964107 N/A 2964109 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2964110 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O00481:p.Leu308_Leu309del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A/E ppl-btn3a1-1 2964107 N/A 2964109 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2964111 unspecified role unspecified role prey prey c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp 1D ppl-btn3a1-2 2964107 N/A 2964109 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2964114 unspecified role unspecified role prey prey c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Supp 1Di btn3a1-ppl-1 2964108 N/A 2964109 unspecified role unspecified role prey prey region(cloneB7) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 26_amino_acids tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 2964110 unspecified role unspecified role bait bait cytoplasmic_tail_region sufficient to bind sufficient binding region sufficient to bind range range range range false 2964209 2964206 physical association physical association false false false no figure