DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tsai-2015-1 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264698X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264700X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264694X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-4 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264696X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264699X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-6 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264695X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation tsai-2015-7 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. DIP original experiment: DIP-264697X Structure (London, England : 1993) 2015 IMEx BAX-induced apoptosis can be initiated through a conformational selection mechanism. Tsai CJ., Liu S., Hung CL., Jhong SR., Sung TC., Chiang YW. Only protein-protein interactions imex curation b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH q07813-1 Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bax-bcl2l11-5 3272840 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-6 3272841 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-7 3272842 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role Q07813-1:p.Lys21Glu K21E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-8 3272843 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-9 3272844 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-10 3272845 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false R1-label R1-label r1 spin label r1 spin label c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role Q07813-1:p.Lys21Glu K21E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bax-bcl2l11-11 3272846 N/A 3272847 unspecified role unspecified role unspecified role unspecified role Region 141-165 Region 141-165 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3272848 unspecified role unspecified role unspecified role unspecified role R1-label R1-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false