DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ childers-2014-1 strain na1000 / cb15 Caulobacter crescentus anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262254X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-2 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262256X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262258X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-4 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262261X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-5 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262255X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-6 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262262X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-7 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262259X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-8 in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262260X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation childers-2014-9 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. DIP original experiment: DIP-262257X PLoS biology 2014 IMEx Cell fate regulation governed by a repurposed bacterial histidine kinase. Childers WS., Xu Q., Mann TH., Mathews II., Blair JA., Deacon AM., Shapiro L. Only protein-protein interactions imex curation a0a0h3c9d0_cauvn divK CCNA_02547 protein protein strain na1000 / cb15 Caulobacter crescentus MTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLERQPA a0a0h3cdi6_cauvn Histidine kinase divL CCNA_03598 protein protein strain na1000 / cb15 Caulobacter crescentus MTSYDLILAAAAGAVCLAISVALWSHGQRRNLEARIVALKTRLIQQGGSDDAPAWLDAFDTAVIAVEGGRANLVAGGEGLIACAKALGADAEVSAVVAALSDADPNYAQKLTALFERGEPCVFEARGPHGLVSVEGRAAGALAWLRLAPIDRADSGLPTAARFAAFVDSVVEPCWIAGADGQAIWGNAAFVRAVGAASAQAPALAGKSFDRGADAVVVEAAGKGERREALRWINVEGRRRAFRLSAQPLDGGGVGVFCADVTEIEDVRDAFKKHVEAHDETLNHIAEAVAIFSQTRRLSYHNTAFAELWGLEPAWLADRPTHGEVLDRLRQRRRLPETIDYAGWKAAELARYEDLGPQADDLWDLPDGRTLKVVRQPHPLGGMLLIYSDITGELRLKAQYNALIQVQQATLDKLNDAVAVFGSDGRLRLHNEAFETFWNVTPHALEAAGDFEGVVELCVPRLHDLSFWRELKGRVADPDPQMRAPTSGEVRTSDSRIVLYQSRPLPDGATLIAFADVTDTRDLQSALADRSAALAEAERLKRDFVGNVSYELRTPLTTIIGYSELLERADGISERGRNHVAAVRAAATQLARSIDDVLDMAQIDAGEMALEIEDIRVSDLLLNAQERALKDAQLGGVTLAVECEEDVGLIRGDGKRLAQTLDHLVENALRQTPPGGRVTLSARRALGEVRLDVSDTGRGVPFHVQAHIFDRFVGRDRGGPGLGLALVKALVELHGGWVALESEPGNGSTFTCHLPETQQPGAMQPELGF a0a0h3c5m8_cauvn Histidine kinase divJ CCNA_01116 protein protein strain na1000 / cb15 Caulobacter crescentus MEFETLPDPFRRPAARAAGLDPAHAWRLGWLAAVCLAAAAALFTADSGGWPVWAALGAGALPALVSLIFTREDERTQSWLLVLWAVGGSLAAVLTGGVGGAMAAWCLAPVAAASTQDQPKRLAEGAALALIGACVAALTQLSGLAPAAPTGPLAFVLGFLALVTTGLGLAAGLLIGRRRQGARDDRYASEIIGLETLLDGLPHLAIAVRGQGQVTAVRGAAPPGVTRADLVNRGLTGAAAPGDRQRLTAAIAQAHREGSASLTFNPALGVERVVALDMHRVAPNQLVGVLRDITVERHREHALDQARIDAEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPLSDRYAEYAELIHESGGHLLDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGRPYEQAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLPVLLAPMVAATPTPPAAPEAPSAPEPAPTVEEPPPASLGDNVIAFAPR a0a0h3c8q4_cauvn Histidine kinase cckA CCNA_01132 protein protein strain na1000 / cb15 Caulobacter crescentus MADLQLQDKVSTGAPRRRFDPWLVGAAVFFVAAAALSAAPALKAGPTTLAGLLLLLGVAGVAVLGLVAIRGSALSGGDADQAEGFIEALAEPAALAAADGRVLAANGPWREVMGEQRRLPKGVAGSSLFAALVQARQGQMAEGMLSAGGTDYTAKVSRLAGGRLMIRLAPIVVAEPVVEDASPAPVAERAAPPPSSLDAFAGASPFGAALLEGLEPFTSRVLETNPALTTMTGAKAGVLFGDLIDAASRAEAETRLNEGRAGPYEVRLARDPSRIAHLYLYRAEGRLVAYMIDVSEQKQIELQLSQAQKMQAIGQLAGGVAHDFNNLLTAIQLRLDELLHRHPVGDPSYEGLNEIRQTGVRAADLVRKLLAFSRKQTVQREVLDLGELISEFEVLLRRLLREDVKLITDYGRDLPQVRADKSQLETAVMNLAVNARDAVRAAKGGGVVRIRTARLTRDEAIQLGFPAADGDTAFIEVSDDGPGIPPDVMGKIFDPFFTTKPVGEGTGLGLATVYGIVKQSDGWIHVHSRPNEGAAFRIFLPVYEAPAGAVAVQAVAEPAKPRAARDLSGAGRILFVEDEDAVRSVAARLLRARGYEVLEAADGEEALIIAEENAGTIDLLISDVIMPGIDGPTLLKKARGYLGTAPVMFISGYAEAEFSDLLEGETGVTFLPKPIDIKTLAERVKQQLQAA a0a0h3ccg1_cauvn Histidine kinase pleC CCNA_02567 protein protein strain na1000 / cb15 Caulobacter crescentus MGRHGGPAAAGPTAPSAVRAKAVNAPSQVFVRIAILAALLLLAVYTAFGVHRLQREAMAQPGGAPLAAKADLIAGRVDANLAAQRAGLSAAADLLKRDPGATMDAAETTLRAAGGEAAAVAVVSEAGVVAVAGRDDGADWKAAALAAGASGRTNWVGSVGETGRLYVATTTSLDRARAFVIASGDASRLVADPEKGESGALALPDGKLIAARGRGVQGAGALREAFALSIEDLGDGPAAVRGQAADGALLDVAVRPVAQGALLAVAAAPTRSVANLDRQVMEGAFSLLVPLGVGIALALLLMIQSRKAEVAHREFIDSERRFRLAVEAARCGIWEWDLNGDQVYLSDVTGAMFGWGGGGVVSGQDLLERISIDHRERVRQALANAAMYGAFDVSFRVPASEQGARSLWIDARGQGFGKPGSEGHARIIGVALDVTEERIAQARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEVNRFAALAIKQDHPAPDGAKGVREAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQEEARRRNEEQLQNAVAGLERSQEQLAELARKYETEKVKAESANKAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFESMHLEDVAEDAVRLVRNRAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSNAIKFTPRAGSVTVRAEVRRDPFGDLIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTTQGTGLGLALTKSLITMHDGVLEMHSTPGEGTTVSFTLPVRHSDQKITRDFVAA divl-divk-1 3294732 N/A 3294741 unspecified role unspecified role prey prey strain na1000 / cb15 Caulobacter crescentus N/A 3294742 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false strain na1000 / cb15 Caulobacter crescentus physical association physical association false false false divj-divk-5 3294733 N/A 3294743 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294741 unspecified role unspecified role unspecified role unspecified role BODIPY-label BODIPY-label bodipy label bodipy label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false divl-1 3294734 N/A 3294742 unspecified role unspecified role unspecified role unspecified role Region 523-769 Region 523-769 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false divj-divk-6 3294735 N/A 3294743 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294741 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false divk-divl-1 3294736 N/A 3294741 unspecified role unspecified role unspecified role unspecified role BODIPY-label BODIPY-label bodipy label bodipy label certain certain sequence position certain certain certain sequence position certain false pRes pRes phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3294742 unspecified role unspecified role unspecified role unspecified role Region 523-769 Region 523-769 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false A0A0H3CDI6:p.Arg553Ala R553A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false A0A0H3CDI6:p.Thr557Asn T557N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false A0A0H3CDI6:p.Tyr562Ala Y562A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false A0A0H3CDI6:p.His579Glu H579E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ccka-1 3294737 N/A 3294744 putative self putative self unspecified role unspecified role Region 70-691 Region 70-691 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false divl-2 3294738 N/A 3294742 unspecified role unspecified role unspecified role unspecified role Region 523-769 Region 523-769 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false divk-plec-2 3294739 N/A 3294745 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3294741 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false divk-plec-3 3294740 N/A 3294745 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294741 unspecified role unspecified role unspecified role unspecified role BODIPY-label BODIPY-label bodipy label bodipy label certain certain sequence position certain certain certain sequence position certain false pRes pRes phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false