DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ darosa-2015-1 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265256X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265252X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265258X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265253X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265255X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-6 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265257X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation darosa-2015-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. DIP original experiment: DIP-265254X Nature 2015 IMEx Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa PA., Wang Z., Jiang X., Pruneda JN., Cong F., Klevit RE., Xu W. Only protein-protein interactions imex curation tnks1_human Poly [ADP-ribose] polymerase tankyrase-1 TNKS PARP5A PARPL TIN1 TINF1 TNKS1 Tankyrase I TNKS-1 TRF1-interacting ankyrin-related ADP-ribose polymerase Poly [ADP-ribose] polymerase 5A ADP-ribosyltransferase diphtheria toxin-like 5 Protein poly-ADP-ribosyltransferase tankyrase-1 Tankyrase-1 protein protein human Homo sapiens Human MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT rn146_human E3 ubiquitin-protein ligase RNF146 Dactylidin RNF146 RING finger protein 146 Iduna RING-type E3 ubiquitin transferase RNF146 protein protein human Homo sapiens Human MMAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDANTVNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDGQLTSPATPSPDASTSLEDSFAHLQLSGDNTAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVSAVVAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVSVRSRRPDGQCTVTEV ub2d1_human Ubiquitin-conjugating enzyme E2 D1 Ubiquitin-protein ligase D1 Ubiquitin carrier protein D1 UbcH5 Ubiquitin-conjugating enzyme E2-17 kDa 1 Ubiquitin-conjugating enzyme E2(17)KB 1 UBC4/5 homolog Stimulator of Fe transport UBE2D1 UBCH5 UBCH5A SFT UBC5A (E3-independent) E2 ubiquitin-conjugating enzyme D1 E2 ubiquitin-conjugating enzyme D1 protein protein human Homo sapiens Human MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM rn146_mouse E3 ubiquitin-protein ligase RNF146 Rnf146 Iduna RING finger protein 146 RING-type E3 ubiquitin transferase RNF146 protein protein mouse Mus musculus Mouse MEMAGCGEIDHSINMLPTNKKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLDCDTNTVNLARESSADGADSGSAQTGASVQLAVPSSTRPLTSVDGQLTSPVTPSPDAGISLEDSFAHLQLSGDSIAERSHRGEGEEDHESPSSGRVPDTSVEETESDASSDSEDAPVVVAQHSLTQQRPLVPNGNQTVADQSDRSGTDRSVAGGGTMSVNVRSRRPDGQCTVTEV tnks1_mouse Poly [ADP-ribose] polymerase tankyrase-1 Tnks Protein poly-ADP-ribosyltransferase tankyrase-1 Tankyrase-1 ADP-ribosyltransferase diphtheria toxin-like 5 TRF1-interacting ankyrin-related ADP-ribose polymerase 1 Tnks1 protein protein mouse Mus musculus Mouse MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGPTPASPTAGGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGAVCTVAAPAAVPAASAAVGVAPTPAGGGGGGGNNSASSASSPTSSSSSSPSSPGSSLAESPEAAGVGSTATLGAGAAGLGPGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPMRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLTDLAVGGASNAGDGAAGAERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT rnf146-tnks-1 3270701 N/A 3270708 unspecified role unspecified role unspecified role unspecified role Region 173-961 Region 173-961 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3270709 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rnf146-ube2d1-1 3270702 N/A 3270710 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3270711 unspecified role unspecified role unspecified role unspecified role Region 30-183 Region 30-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnks-rnf146-1 3270703 N/A 3270708 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270709 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9NTX7:p.Gly200Val G200V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9NTX7:p.[Gly200Val;Gly338Val;Gly339Val] G200V/G338V/G339V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false rnf146-ube2d1-2 3270704 N/A 3270710 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3270711 unspecified role unspecified role unspecified role unspecified role Region 30-183 Region 30-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rnf146-tnks-2 3270705 N/A 3270708 unspecified role unspecified role unspecified role unspecified role Region 173-961 Region 173-961 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3270709 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rnf146-tnks-3 3270706 N/A 3270712 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3270709 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rnf146-tnks-4 3270707 N/A 3270708 unspecified role unspecified role prey prey Region 173-961 Region 173-961 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3270709 unspecified role unspecified role bait bait Q9NTX7:p.Gly200Val G200V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region 1-205 Region 1-205 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9NTX7:p.[Gly338Val;Gly339Val] G338V/G339V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9NTX7:p.[Gly200Val;Gly338Val;Gly339Val] G200V/G338V/G339V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false