DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kumar-2014-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266693X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266705X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266701X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266698X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266704X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266699X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266702X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-8 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266696X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266694X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-10 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266706X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-11 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266697X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-12 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266695X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-13 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266700X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation kumar-2014-14 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar M., Kong K., Javier RT. DIP original experiment: DIP-266703X Journal of virology 2014 IMEx Hijacking Dlg1 for oncogenic phosphatidylinositol 3-kinase activation in human epithelial cells is a conserved mechanism of human adenovirus E4-ORF1 proteins. Kumar M., Kong K., Javier RT. Only protein-protein interactions imex curation q2y0f1_ade03 E4 protein protein hadv-3 Human adenovirus B serotype 3 HAdV-3 Human adenovirus 3 MADEALYVYLEGPGATLPEQQQRNNYIFYSPVPFTLYPRGVALLYLKLSIIIPRGYVGCFFSLTDANMSGLYASSRIIHAGHREELSVLLFNHNDRFYEGRAGDPVACLVMERLIFPPVRQATMI p85b_human Phosphatidylinositol 3-kinase regulatory subunit beta PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta protein protein human Homo sapiens Human MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALGPAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPAAR p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR dlg1_human Disks large homolog 1 DLG1 Synapse-associated protein 97 hDlg protein protein human Homo sapiens Human MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL pk3ca_human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Phosphoinositide-3-kinase catalytic alpha polypeptide Serine/threonine protein kinase PIK3CA PIK3CA Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha Phosphoinositide 3-kinase alpha protein protein human Homo sapiens Human MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN d4n3l3_9aden protein protein human adenovirus 36 Human adenovirus 36 MAESLYAFIDSPGGIAPVQEGASNRYIFFCPESFHIPPHGVILLHLRVSVLVPTGYQGRFMALNDYHARGILTQSDVIFAGRRHDLSVLLFNHTDRFLYVREGHPVGTLLLERVIFPSVRIATLV e4or1_ade09 E4-ORF1 E4 Probable dUTPase E4 ORF1 Early E4 14.0 kDa protein ORF1 protein protein hadv-9 Human adenovirus D serotype 9 MAESLYAFIDSPGGIAPVQEGTSNRYTFFCPESFHIPPHGVVLLHLKVSVLVPTGYQGRFMALNDYHARDILTQSDVIFAGRRQELTVLLFNHTDRFLYVRKGHPVGTLLLERVIFPSVKIATLV mint homomint Plays a key role in virus oncogenecity in animals. Binds and sequesters human MUPP1/MPDZ protein in the cytoplasm, preventing it from playing a role in cellular proliferation regulation. Induces cell transformation, probably by inactivating MPDZ protein q6vgs8_ade05 E4 protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLRLRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFPVVRQASNV e413_ade12 Probable early E4 13 kDa protein protein protein ade12 Human adenovirus A serotype 12 (HAdV-12) Human adenovirus 12 MPLPCIPPPPVSRDTAACIAWLGLAHASCVDTLRFIKHHDLKITPEAEYILASLREWLYFAFLTERQRCKQKGRGAITSGRTWFCFFKYEDARKSVVYDAARQTVSLQIGTIQQVPTTAL mint pik3ca-dlg1-1 3270228 N/A 3270242 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270246 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false dlg1-d4n3l3_9aden-1 3270229 N/A 3270247 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-e4-5 3270230 N/A 3270248 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-e4-6 3270231 N/A 3270242 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-d4n3l3_9aden-2 3270232 N/A 3270247 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-e4-7 3270233 N/A 3270249 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-pik3ca-1 3270234 N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false pik3ca-dlg1-2 3270235 N/A 3270250 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270246 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false pik3ca-dlg1-3 3270236 N/A 3270249 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270246 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false pik3ca-d4n3l3_9aden-1 3270237 N/A 3270247 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270246 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false dlg1-e413_ade12-1 3270238 N/A 3270250 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false pik3ca-dlg1-4 3270239 N/A 3270248 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270244 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270246 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false dlg1-e4-8 3270240 N/A 3270248 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false dlg1-pik3ca-2 3270241 N/A 3270243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3270245 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3270246 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false