DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2014-26 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262026X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-27 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262018X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-28 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262012X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-29 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262021X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-30 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262027X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-31 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262015X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-32 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262030X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-33 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262025X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-34 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262019X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-35 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262022X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-36 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262013X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-37 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262029X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-38 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262023X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-39 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262016X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-40 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262024X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-41 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262020X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-42 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262028X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-43 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262014X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation zhang-2014-44 schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. DIP original experiment: DIP-262017X PLoS biology 2014 IMEx Fission yeast Pxd1 promotes proper DNA repair by activating Rad16XPF and inhibiting Dna2. Zhang JM., Liu XM., Ding YH., Xiong LY., Ren JY., Zhou ZX., Wang HT., Zhang MJ., Yu Y., Dong MQ., Du LL. Only protein-protein interactions imex curation ycd2_schpo Uncharacterized protein C1322.02 SPCC1322.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MIESKGETAPSLNLNDVNVEENDAAQSFAEKVQRFRYQMKVHAAPRQKTLHSFLKKDNANIHDFTKVEKPHIRSSKSKVSYNSITSRVTKYFEEKNNSVDQLHSESLTPLSFGHTIPKKKPLLMTASVSEDSRVRVSKRQFKSKVVHPEIAISIAKRHKPKFPLSDELMNVEPGFHHSNIGCQITPYLWISSFRTNVYYLIGNEGDLLSQQVPSISGELNMLRGVCTRIDDDNRYDIEQAGSCFGMSVFPTSDSGEESFTTLESDPIVNCEHDEKKVADNLLVPQVMCSSNISTFFRSPGGKKLYHYLWKNSNALRISSNDLLEILLKHGVYVSLDTLHSWLQERNVNFEK AC14FEC1DC7355F3 rad16_schpo DNA repair protein rad16 rad16 rad10 rad20 swi9 SPCC970.01 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast METKVHLPLAYQQQVFNELIEEDGLCVIAPGLSLLQIAANVLSYFAVPGSLLLLVGANVDDIELIQHEMESHLEKKLITVNTETMSVDKREKSYLEGGIFAITSRILVMDLLTKIIPTEKITGIVLLHADRVVSTGTVAFIMRLYRETNKTGFIKAFSDDPEQFLMGINALSHCLRCLFLRHVFIYPRFHVVVAESLEKSPANVVELNVNLSDSQKTIQSCLLTCIESTMRELRRLNSAYLDMEDWNIESALHRSFDVIVRRQLDSVWHRVSPKTKQLVGDLSTLKFLLSALVCYDCVSFLKLLDTLVLSVNVSSYPSNAQPSPWLMLDAANKMIRVARDRVYKESEGPNMDAIPILEEQPKWSVLQDVLNEVCHETMLADTDAETSNNSIMIMCADERTCLQLRDYLSTVTYDNKDSLKNMNSKLVDYFQWREQYRKMSKSIKKPEPSKEREASNTTSRKGVPPSKRRRVRGGNNATSRTTSDNTDANDSFSRDLRLEKILLSHLSKRYEPEVGNDAFEVIDDFNSIYIYSYNGERDELVLNNLRPRYVIMFDSDPNFIRRVEVYKATYPKRSLRVYFMYYGGSIEEQKYLFSVRREKDSFSRLIKERSNMAIVLTADSERFESQESKFLRNVNTRIAGGGQLSITNEKPRVIVDLREFRSSLPSILHGNNFSVIPCQLLVGDYILSPKICVERKSIRDLIQSLSNGRLYSQCEAMTEYYEIPVLLIEFEQHQSFTSPPFSDLSSEIGKNDVQSKLVLLTLSFPNLRIVWSSSAYVTSIIFQDLKAMEQEPDPASAASIGLEAGQDSTNTYNQAPLDLLMGLPYITMKNYRNVFYGGVKDIQEASETSERKWSELIGPEAGRRLYSFFRKQLKDYE B08764366A445CF6 cdc24_schpo Cell division control protein 24 cdc24 SPAC8F11.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDFPGLIKKIKEDLENRLVEKSKQPAFTDYWLINKTISLLKEYPSGFSYPILINEIELACSERNKLDNVFSSLEWLTKSDAVIYLEDQFHFHCYDYYYTPIPSLKLKDSEENTCEMILHSSFYLLFHEPFNILKGSTLRFSQSRIHQKWYLRKQIRFLPTTSFVPVLQYAASKSFVKSMVESTEHEFFQIRDITISKSDQGVKRITVELGRIISLDKKGAFLIDNNTNFIHFSGTYHDFPKLLDKQQYLLIPFWSTVWEGSTNWQDGMIGILVILSENDFEEKKCDSWQVGRLAAVNSNFLVLDNNGQRVKILYSNSQKHYFKDTYIGDLLCISPINHSSDNLSDYSCVSDTTTEILSNLENPLSSNFLRNDLCKFSNLFSGVSGHLKIQPLTLVITGFVANLTRQSDLNTSLVLPEVNPLTAKMEVIDCLRNSFWAALRPNCVSYFASMISGFKELFQKEMEFPIYLDLKSYKLGFHWCDIYVDSEHNCHIQKINSLPCE 66E84CCB46244863 dna2_schpo DNA replication ATP-dependent helicase/nuclease dna2 dna2 SPBC16D10.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFNDQSKTTSSVKGICATTDNNHGNLKKTNSTPFRKNYLLNGRTKLKLENFAYNASTEISSPKISEKKHSSLPIKRKNTFNESSTSFSPFTKAHKEITDDLKPDKSFTRKSDLNSQDMPVCFQETSKDLCRSSSTQHLLDHQTTDSTIIDMKPVSTNSKSDVFTLYTDETVLLRRCASDNKPLINNNLSSSNVSENQSRSFGSYDEVKNQGNNLHKVPSLVSIIRNARSSEQSRIAANSSCLLKGSDTEIDEDDFALEAEDLAALDSLERQYSQLPNSTVTASAKDIEKTAKVNHVGGDLQSYCSATKASDATINEEPVNLALDKACNSLPDINSDFIDDWDDSCDGCTPGELCEFSSEYTVLEVHEDFIFHEGNHFRQLKLILEANDILHQLFLRGDWTETSIFVGDSIRVEATFDKDNTAIVDNDKGLIIIHPKILMSATAVASSFPCLRKAVISDRVGIYGPPTKAMVTGNILHDFFQHALYRGIDALENVDINLETSIKTYISDIYFADLSLDEIREELDARLPLLKSIVERYLISKKNDNNNESIHISRLLDIEESIWSPRFGLKGNIDATVEVVLTEKPESSSTLTLPLELKTGRYVDNISHFAQSLLYTLLISDRYGINTNQALLCYLENSTIKNLVASNSQLRGLIMTRNSLAQHNFRRSLPEMISNRKICDHCSLVSECLFFQKMSDKGVANSNGLTESWNEWMREVKDEDLEFYKKWEKLLNQEERLLLLKRGDVLTFDTEELEAYGKTLYPLYITKEDIVCLEIDDRVFHYKFAFLNDNGYPRNFLHSGFSVGERVFISDEHGHWSLAKGHIVHIQDSCIEVRTRHRLHIPWLKMPNFDFKKNQVFFGNYEDSKLSFIGSNHTRYRIDKDEFSSGIASIRGTLMSSVLPDAPLIIRDMIIRLKPPKFCNSALIDPEFLKCLNEDQITALKKCHAAEHYSLILGMPGTGKTTTISSLIRSLLAKKKKILLTSFTHLAVDNILIKLKGCDSTIVRLGSPHKIHPLVKEFCLTEGTTFDDLASLKHFYEDPQIVACSSLGVYHSIFNKRKFDYCIIDEASQIPLPICLGPLQLAEKFVLVGDHYQLPPLVKNSRTSKDGLSLSLFKLLSEKHPEAVTTLRLQYRMNEDINSLSSELIYGGNLVCGSKTISQKKLILPKAHLSDGLPDSSSSLHWVNKLINPSHSVIFFNTDDILGVESKTNNILENHTEAFLIEQAVSSFLERGVKQSSIGIISIYKSQVELLSKNLKSFTEIEINTVDRYQGRDKDIILISFVRSNSKNLVGELLRDWHRLNVALSRAKVKCIMFGSLSTLSSSNIVSHLLKLLEKNKWIFTLNENDIATKFDENSSPIKDCSQVATTNNAKVIIRKNQRFFNSDNLCEKAILPQLEF 5BE34210382E4B8C swi10_schpo Mating-type switching protein swi10 swi10 SPBC4F6.15c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSDIDDEEFEQLAVSALEEVEKKAGFAQQPTPQKVSRVTAHSILVNPRQKGNPLLPHVRNVPWEYTDIVPDFVMGTGICSLFLSLKYHHLHPEYIYSRISKLGKSYNLRILLILVDVENHQASIQELVKTSIVNQYTLILAWSSEEAARYLETYKAYENMSPALIMEKPSTDYLSQVQSFLTSIRGINKSDSLSLLSKFGSLERALVASRDELEQLEGWGPTKVNRFLEAVQQPFMSHSTIKRPEAINLKQT C08FC0DA01F04EA7 yhag_schpo Uncharacterized protein C409.16c SPBC409.16c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MCSVEKIVRLRHNLLCHVRIHFKTKEDLDIRAFLFSLQRELHAVAFLNQGSIRTLYEKRVVDITSESVQSHAIIETARNFALPNTAEEEENMDRKPELQLSFKGSMTSKIIHIYVQPFDS F90E8FD397CBA10A pxd1-rad16-1 3269640 N/A 3269659 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3269660 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad16-pxd1-1 3269641 N/A 3269659 unspecified role unspecified role prey prey Smt3-tag Smt3-tag fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 101-226 Region 101-226 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O94542:p.[Ala155Asp;Glu172Ala] A155D/E172A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269660 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false saw1-cdc24-1 3269642 N/A 3269661 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269662 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269663 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269664 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false cdc24-dna2-1 3269643 N/A 3269661 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 80-335 Region 80-335 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269662 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false pxd1-dna2-1 3269644 N/A 3269662 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3269659 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pxd1-cdc24-1 3269645 N/A 3269661 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 227-351 Region 227-351 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 234-351 Region 234-351 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false cdc24-dna2-2 3269646 N/A 3269661 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3269662 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc24-dna2-3 3269647 N/A 3269661 unspecified role unspecified role unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269662 unspecified role unspecified role unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast direct interaction direct interaction false false false cdc24-pxd1-1 3269648 N/A 3269661 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role prey prey Region 227-351 Region 227-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O94542:p.[Ser289Ala;Ser290Ala;Ile292Ala;Phe295Ala;Phe296Ala] S289A/S290A/I292A/F295A/F296A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Smt3-tag Smt3-tag fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rad16-pxd1-2 3269649 N/A 3269659 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-451 Region 1-451 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false pxd1-cdc24-2 3269650 N/A 3269661 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269662 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269663 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269664 unspecified role unspecified role bait bait schpm Schizosaccharomyces pombe (fission yeast) Fission yeast association association false false false cdc24-pxd1-2 3269651 N/A 3269661 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3269659 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad16-swi10-1 3269652 N/A 3269663 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false rad16-cdc24-1 3269653 N/A 3269661 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false cdc24-pxd1-3 3269654 N/A 3269661 unspecified role unspecified role unspecified role unspecified role schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role unspecified role unspecified role Region 227-351 Region 227-351 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cdc24-pxd1-4 3269655 N/A 3269661 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 80-245 Region 80-245 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 161-501 Region 161-501 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269659 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false rad16-swi10-2 3269656 N/A 3269663 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3269660 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pxd1-rad16-2 3269657 N/A 3269659 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 108-226 Region 108-226 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 101-351 Region 101-351 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-233 Region 1-233 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269660 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false saw1-cdc24-2 3269658 N/A 3269661 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast N/A 3269664 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association false false false