UniProt UniProt http://www.uniprot.org swamynathan-2014-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Investigative ophthalmology & visual science 2014 imex curation Only protein-protein interactions swamynathan-2014-1 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Investigative ophthalmology & visual science 2014 imex curation Only protein-protein interactions swamynathan-2014-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Swamynathan S., Swamynathan SK. swamynathansk@upmc.edu Investigative ophthalmology & visual science 2014 imex curation Only protein-protein interactions urok_mouse Urokinase-type plasminogen activator Plau protein protein mouse Mus musculus Mouse MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKMLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIGEEKGLAF mint Specifically cleave the zymogen plasminogen to form the active enzyme plasmin slur1_mouse Secreted Ly-6/uPAR-related protein 1 Ars Slurp1 ARS component B protein protein mouse Mus musculus Mouse MTLRWAMWLLLLAAWSMGYGEAFRCYTCEQPTAINSCKNIAQCKMEDTACKTVLETVEAAFPFNHSPMVTRSCSSSCLATDPDGIGVAHPVFCCFRDLCNSGFPGFVAGL urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL slur1_human Secreted Ly-6/uPAR-related protein 1 ARS ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein SLURP1 protein protein human Homo sapiens Human MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL slurp1-plau-3 2971103 N/A 2971106 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Cleaved MBP-tagged PLAU/uPA also binds. However, the range of the binding peptide cannot be determined. N/A 2971107 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4C slurp1-plau-4 2971103 N/A 2971106 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-kidney Mus musculus kidney kidney [Renal] N/A 2971107 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 4C slurp1-plau-5 2971103 N/A 2971108 unspecified role unspecified role prey prey Recombinant protein has been used but expression system is not given in the publication N/A 2971109 unspecified role unspecified role bait bait Recombinant protein has been used but expression system is not given in the publication direct interaction direct interaction false false false 4C slurp1-plau-1 2971104 N/A 2971106 unspecified role unspecified role prey prey mouse-kidney Mus musculus kidney kidney [Renal] N/A 2971107 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 4A slurp1-plau-2 2971105 N/A 2971106 unspecified role unspecified role prey prey mouse-kidney Mus musculus kidney kidney [Renal] N/A 2971107 unspecified role unspecified role bait bait n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 4B