DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kuwasako-2014-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kuwasako K., Takahashi M., Unzai S., Tsuda K., Yoshikawa S., He F., Kobayashi N., Güntert P., Shirouzu M., Ito T., Tanaka A., Yokoyama S., Hagiwara M., Kuroyanagi H., Muto Y. DIP original experiment: DIP-262121X Nature structural & molecular biology 2014 IMEx RBFOX and SUP-12 sandwich a G base to cooperatively regulate tissue-specific splicing. Kuwasako K., Takahashi M., Unzai S., Tsuda K., Yoshikawa S., He F., Kobayashi N., Güntert P., Shirouzu M., Ito T., Tanaka A., Yokoyama S., Hagiwara M., Kuroyanagi H., Muto Y. Only protein-protein interactions imex curation o45189_caeel sup-12 T22B2.4 CELE_T22B2.4 protein protein caeel Caenorhabditis elegans MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGLPQMYYPTVTGLVNPLMAQQGAAAQQQLFDYNALAAVMNPQAAAAYGIQSQGKFAAAPTTIEQYAAYPAGYGLVPQSAYNIGNPQLQQLAAAQQQLEHQRV g5eew7_caeel asd-1 R74.5 CELE_R74.5 protein protein caeel Caenorhabditis elegans MTTAAEIITVEKLNDFDYKVALQQQMVAAQNGAAAAVLRPHQIGSSPEAPQSQTSGGSTEQLQQQPLPPPTQQKQQQPLTIGPVAPNDRSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNALISQQQQIQRAALLQQQLLAQQFLVPRHQQLMMPPTSAAAISQLQALQYQQALLAAQQQQQQMQNPQFLLSLQQQQQAQAQAPPTSMAQLIQHQQQFAMDPMAQAQAQAAQAQMVTLIAFEQQRMQLQAAAAAAQGRGVPQPGRIPTSTATTGSSQNQVAAGSIGEQYLQQSMQGAVPANFHHHSQALHPAAAAAAALQRRFAPY asd_1-sup_12-1 3269108 N/A 3269109 unspecified role unspecified role unspecified role unspecified role Region 20-121 Region 20-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3269110 unspecified role unspecified role unspecified role unspecified role Region 97-190 Region 97-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false