DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2014-35 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261898X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions imex curation liu-2014-36 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261900X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions imex curation liu-2014-37 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261902X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions imex curation liu-2014-38 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261901X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions imex curation liu-2014-39 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. DIP original experiment: DIP-261899X Structure (London, England : 1993) 2014 IMEx Translation initiation factor eIF3b contains a nine-bladed β-propeller and interacts with the 40S ribosomal subunit. Liu Y., Neumann P., Kuhle B., Monecke T., Schell S., Chari A., Ficner R. Only protein-protein interactions imex curation g0s5v8_chatd Eukaryotic translation initiation factor 3 subunit G TIF35 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit homolog CTHT_0033790 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAARTKHDWADDEDIEETTNDLPPPQKIQNKDGSTTIIEYRYNENGQKVKTTRRIRYITHREVVSPLVAERKTWAKFGASAKDPPGPASDTTSVGENIIFRPSVNWKKEAKDESKDPNAQAMKDKLKDKKVKCRICNGEHFTARCPYKDTMAPIGETAPADVAAGLGDEAPGAAGPGKKGSYIPPALRAGARPEGDRLGGKYGERDDMATLRVTNVSELAEESELREMFERFGRVTRVFLAKDRETGLAKGFAFISFADRADAVRACQKMDGFGFKHLILRVEFAKKAQ g0s9h3_chatd Eukaryotic translation initiation factor 3 subunit I TIF34 Eukaryotic translation initiation factor 3 39 kDa subunit homolog CTHT_0045890 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MRPILLKGHERALTQIRYNREGDLIFSVSKDQQICVWFSHNGERLGTYRGHQGAIWTVDVDPTTTMIASGSADNTIRLWDVKTGRLLKTWDFPTAIKRVEFNEDGTKLVAVTEKRMGHLGTIVVLNINPDVNAEQSDEKALVIVCEESKATVAGWSYLSKYIIAGHEDGSISQYDAKTGDLLLNIPIHELNNPITDLQWSADRTYFITASKDKTAKLITAKDLEVLKTYTADTPLNSATITAKKDFVILGGGQAAMEVTTTAVRQGKFEARFYHKIFEDEIGRVRGHFGPLNTVAADPTGKGYASGGEDGYVRVHHFDKGYFDFMYEVERERANKLAQQAAQAQAAAAPATAKA g0sfl2_chatd Eukaryotic translation initiation factor 3 subunit C NIP1 Eukaryotic translation initiation factor 3 93 kDa subunit homolog Translation initiation factor eIF3, p93 subunit homolog CTHT_0071240 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSRFFRGGDSSTESSSDEEELYTTSEEEEEEEIEEQEESEEEEEEDEESSSSDDEGAARTGVNRFLRAMSESESESDDEEGQHKVKSAKDKRHEELEATIIAIQNSQKINDWSTIANEFDKLNRQVVKLVEGGKAPKSYIKCIAELEDFLNETLAKQKVTPKKMNATNARGLNAVKQKIKKNNKEYQSQIDAFRKDADAFMESSDEEEVPLPPKPTKVKFQDAFVAEEGPEDEEKGFSKVDKRGKAVPYSPESIQKHLRAIIESRGRKNVDRMEQIRVMEELTKIAEIPYLKIRVLQTLISTRFDLGSGAAAAMPLEQWKAAEKELSTLLTILEENKDHVVLENAEDLDDDEKVPTLGPDDKHIKIPGSVVSYIERLDDELTRSLQNIDPHTSEYIERLTDETSVYNLILKGLLYYETIRKDASLDVPQESLNRVIQRRLEHVYFKPAQVVKILEENSWKRVAGEINSSITPRSLSADPSKLIQVLCSYLFDNSEGIIRARAMLCQIYFLALHDEYYKARDMMLTSHLQENITNFDIATQILYNRTLVQVGLCAFRKGLIYDAQNTLQDICGSGRQKELLAQGVMIQRYSQVSPEQERLEKQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDIKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQASKALAAGEWKKAIDFIHSIKIWDLMPKADEIKVMLAKQIQEEGLRTYLFTYAPFYDTLSIDTLSTMFELEPRKVASVVSKMISYEELAAALDQVTNTIIFRKGVELSRLQSLALALSDKASALIETNERTLEQRTQGSASAFNRKDGRQGGQRTGGQRTGRSGPRPGGNTQRQAGGTQFTGGALGAAVRG g0rxs6_chatd Eukaryotic translation initiation factor 3 subunit B PRT1 Eukaryotic translation initiation factor 3 90 kDa subunit homolog Translation initiation factor eIF3, p90 subunit homolog CTHT_0000230 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAPSFDHLREEDLDEEDIDMDEVDISDLREKYEVQLEQGYDTFVVIDGLPAVSEEQKPKLIKFLLKKLNTVGKTREDMIYMPMGDDGMSLRFAFVEYSSPAEASAAVRQLDYVPLDKKHTLRVNKLTDIDRYGREGRISEEFVPPKIEPFQEKEHLRWFMADPADRGRDQFVMYRGDTVGVFWNNEKDQPENIVDRQHWTETFVQWSPLGTYLTSVHAQGVQLWGGASWSRLRRFPHPFVNLVAFSPGEKYLVTWSNRPIQIPDSGHPVLTLDDDGKNYIIWDIETARPLRSFAQQDIHPEEHGPKKGPPKFPWPVFKWSADDKYVARLNQGTSISIYELPKMNLLDKQAVKIEGVMDFEWAPATVQREGVKTYEQLFCFWTPEIGNNPARVGLMSIPSKQIVRTLNLFSVSDVKMHWQSEGTYLCVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFVIITTPEPVGATAVPPKTSVSFFCPELKKGNQVGSFKHLRTLEKKNHNAIYWSPKGRFVVIATVHNTQSSDLEFWDLDFDGEKPENEKDLAACLQLMGTGDHYGITDVEWDPSGRYVATWASAWKHTMENGYHLYDFKGELLREEHIEKFKQWQWRPRPPTLLTKEEQKQIRKNLREYSRIFEQEDAERISSADVAVVEARRRLLNEWYAWREAIEKEVAEERAALGLPADPAAELLKRKIAEVAPDAQEQVIEEIMEEVLEETEEIVN g0shb1_chatd Eukaryotic translation initiation factor 3 subunit A TIF32 Eukaryotic translation initiation factor 3 110 kDa subunit homolog Translation initiation factor eIF3, p110 subunit homolog CTHT_0069380 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MPPPPHQKPENVLKRAQELIGVNQAPAALSLLHEHVTSKRSRNVPITSLEPVMLLLVELAVEQKKGKLAKDALYQYKNIAQNTNVATIELVLKKFIELASEKVKAAQQKAEEVQSSIESAAVEDLEASETPESILLATVSGEQSKDRTDRAIVTPWLKFLWEAYRTVLDILRNNARLEILYQSTAMQAFDFCLKYTRKTEFRRLCELLRNHVQTAAKYSAQMHAINLSDPDTLQRHLETRFQQLNVAVDLELWQEAFRSVEDIHTLLTLSKRPPKNIMMANYYEKLTRIFLVGENYLFHAAAWLRYYNLLRHSAALLATGQSKKADNPPATEADLQKAATFVVLSALSIPVISTSRSRGAMVDFDEARKTKNSRLTHLLGMTQAPTRASLFRDVQSKSLLRRAQPQIRELYTILEVDFHPLSICQKISPILKQIGADPEMQKYIAPLQQVILTRLFQQLSQVYETVDLSFVESLAQFPEPFQVSRGMIEKFIMNGNKKGDLSIRMDHATGVLSFDVDVFSSARAAHAGSAAGSAESETGSVQRLQSTPSQIVRSQLTRLAEALFTSCRYIDPSFNEAQIKAREAALARAKAGAEKEHLEVLARKEIIQRRKDQASEAQAQREKENARRKMLQEQALQQAEAARLAEEARIREQKRLQSEREAIKRKEVENMLKDMKLDSVNLEDLENLDSNKIRMIKLQQLEREKNTIAEKLRITGKRLDHLERAYRREEAKKLPEDYAKQRERDLAAYEAMKARTLKEAEQKHKEDLELKHRLSRLMPFYESFRAELHERRREQFEKRRRDAEREFEKAVNQRRKEYRERKLREKREREEKERALREAEERAAREREEERKRQEARREELQRLREEREKERERAREAAARQQQREEEAMARRRAEKEKQAAAAAAGSLPIREPQPISTSGPPRLNLIGGKTPTWREREAAKQAAAAGGAAPPSENNTPPPAARPTPPPMERSSSSDVPSAGPPRLPLAGAAKPGGWRERLAAKEAAAKEAAASGNAPPPGPPPRTGSGRGVPLDRTGSGRGVPLDRVGSGRGGSKDSKEPAPEPLKPSGAPGKWVPRFRRENAGN g0sgx1_chatd CTHT_0067870 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MMASTTRPGLVSALRGVSRRITSRQCRSLEHQFRLLSISTPCSSDMALEPIKPGSADIQAAPEIDLVALAKKYRLAEHARTVPASPSYFSKSPKFNDAFVRVEALYRKYGHLPTLPPADVERVAWKRLKDARTDFNERVKATDYVRCLFIVKSLHSIHPDLKPAEVTEALQVFKRDIQGFLNKPKPVPIDKYGRALGVGKRKASTARAYVLEGNGEVLINGKTLAEYFGRVHDRETAIWPLTATDRIDKYNVWVRVEGGGTTGQADAIKLAIAKGLLAHEPALKPALRRAGCITRDPRTVERKKPGRKKARKGLTWVKR nip1-prt1-22 3265597 N/A 3265602 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265603 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265604 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265605 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265606 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false prt1-tif34-32 3265598 N/A 3265602 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265603 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265605 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false g0sgx1_chatd-prt1-1 3265599 N/A 3265607 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3265605 unspecified role unspecified role prey prey Region 167-746 Region 167-746 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false g0sgx1_chatd-prt1-2 3265600 N/A 3265607 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3265602 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3265603 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3265605 unspecified role unspecified role prey prey Region 167-746 Region 167-746 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false nip1-prt1-23 3265601 N/A 3265604 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265605 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3265606 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false