DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gristick-2014-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260880X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation gristick-2014-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260882X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation gristick-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260884X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation gristick-2014-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260881X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation gristick-2014-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260885X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation gristick-2014-6 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. DIP original experiment: DIP-260883X Nature structural & molecular biology 2014 IMEx Crystal structure of ATP-bound Get3-Get4-Get5 complex reveals regulation of Get3 by Get4. Gristick HB., Rao M., Chartron JW., Rome ME., Shan SO., Clemons WM. Only protein-protein interactions imex curation mdy2_yeast Ubiquitin-like protein MDY2 MDY2 TMA24 Mating-deficient protein 2 Translation machinery-associated protein 24 GET5 Golgi to ER traffic protein 5 YOL111C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSASGPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQNRAKKLKLHQDQQGQDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNPTISKEPEAEKSTNSPAPAPPQELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK CE6FC4282E0E472C get4_yeast Golgi to ER traffic protein 4 GET4 O3580 YOR164C Guided entry of tail-anchored proteins 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFLQDMMSGFLGGSK 98AFFDB4EA51B40F get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 get3-get4-1 3264876 N/A 3264882 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264883 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264884 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false get4-get5-1 3264877 N/A 3264882 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264883 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false get3-1 3264878 N/A 3264884 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false get3-get4-2 3264879 N/A 3264882 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264883 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264884 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false get4-get3-1 3264880 N/A 3264883 unspecified role unspecified role bait bait Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3264884 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false get4-get5-2 3264881 N/A 3264882 unspecified role unspecified role unspecified role unspecified role Region 1-54 Region 1-54 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3264883 unspecified role unspecified role unspecified role unspecified role Region 11-290 Region 11-290 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false