DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ maclean-2014-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260655X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260665X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260664X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-4 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260675X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260656X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260673X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260681X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260666X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260680X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260674X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260657X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260667X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260658X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260668X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260659X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-16 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260676X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260669X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-18 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260678X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260660X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260661X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260670X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-22 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260677X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260662X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-24 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260671X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-25 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260663X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-26 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260679X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation maclean-2014-27 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. DIP original experiment: DIP-260672X PLoS biology 2014 IMEx Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner. MacLean AM., Orlovskis Z., Kowitwanich K., Zdziarska AM., Angenent GC., Immink RG., Hogenhout SA. Only protein-protein interactions imex curation sep3_arath Developmental protein SEPALLATA 3 Agamous-like MADS-box protein AGL9 SEP3 AGL9 At1g24260 F3I6.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQMPLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQDGMGAGPSVNNYMLGWLPYDTNSI q2njq2_aywbp SVM_signal domain-containing protein AYWB_224 protein protein aywbp Aster yellows witches'-broom phytoplasma (strain AYWB) MFKIKNNLLLLLNVFVFAFLGLFLINNNQQVMGMDKDIASTSNNNPNITNYSIEENIINLKYKIRENAVKKINIENEIQQLSNNEPRKNTLLTLKKNLENLINNQKEQLKTYQILLKTLNDENN ap1_arath Floral homeotic protein APETALA 1 Agamous-like MADS-box protein AGL7 AP1 AGL7 At1g69120 F4N2.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSCMEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRTRKNQLMYESINELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNQGHNMPPPLPPQQHQIQHPYMLSHQPSPFLNMGGLYQEDDPMAMRRNDLELTLEPVYNCNLGCFAA agl8_arath Agamous-like MADS-box protein AGL8 Floral homeotic protein AGL8 Transcription factor FRUITFULL AGL8 FUL At5g60910 MSL3.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCMERILERYDRYLYSDKQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKEREKKTGQQEGQLVQCSNSSSVLLPQYCVTSSRDGFVERVGGENGGASSLTEPNSLLPAWMLRPTTTNE agl12_arath Agamous-like MADS-box protein AGL12 AGL12 Protein XAANTAL 1 XAL1 F14O23.5 F26A9.6 At1g71692 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARGKIQLKRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELATKGTMEGMIDKYMKCTGGGRGSSSATFTAQEQLQPPNLDPKDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEENNNSILDANFAVMETNYSYPLTMPSEIFQF flc_arath MADS-box protein FLOWERING LOCUS C FLC FLF MADS-box protein FLOWERING LOCUS F T31P16.130 At5g10140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQISDNLPVTLPLLN rd23d_arath Ubiquitin receptor RAD23d RAD23D Putative DNA repair protein RAD23-4 RAD23 RAD23-4 RAD23-like protein 4 MXI10.20 At5g38470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAEYPAAKQMLIHQGKVLKDETTLEENNVVENSFIVIMLSKTKASPSGASTASAPAPSATQPQTVATPQVSAPTASVPVPTSGTATAAAPATAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPAQAEIPPVAQAPATGEQAANPLAQPQQAAAPAAATGGPNANPLNLFPQGMPAADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEENVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFEDQ cal_arath Transcription factor CAULIFLOWER Agamous-like MADS-box protein AGL10 CAL AGL10 At1g26310 F28B23.24 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSSESCMEKVLERYERYSYAERQLIAPDSHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKERENILRTKQTQCEQLNRSVDDVPQPQPFQHPHLYMIAHQTSPFLNMGGLYQEEDQTAMRRNNLDLTLEPIYNYLGCYAA rd23c_arath Ubiquitin receptor RAD23c RAD23C Putative DNA repair protein RAD23-3 RAD23 RAD23-3 RAD23-like protein 3 F16B3.17 At3g02540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIEENKVAENSFIVIMMNKSKPASAAASSASAGTSQAKSIPPSTSQPSISPQTPASVSAPVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVPATISSSTPAPDSAPVGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPEQAEVPPVARPPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNVGGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE maf5_arath Protein MADS AFFECTING FLOWERING 5 MAF5 AGL68 FCL1 MADS box protein FCL1 MADS-box protein AGAMOUS-LIKE 68 F15O5.4 At5g65080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRRVEIKRIENKSSRQVTFCKRRNGLMEKARQLSILCGSSVALFIVSSTGKLYNSSSGDSMAKIISRFKIQQADDPETLDLEDKTQDYLSHKELLEIVQRKIEEAKGDNVSIESLISMEEQLKSALSVIRARKTELLMELVKNLQDKEKLLKEKNKVLASEVGKLKKILETGDERAVMSPENSSGHSPPETLPLLK q9at76-1 Agamous-like MADS-box protein AGL27 AGL27 FK1 FLM MAF1 MADS box FLC1-like nuclear protein Protein FLOWERING LOCUS M Protein MADS AFFECTING FLOWERING 1 F22K20.15 At1g77080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDDISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQMGKNTLLATDDERGMFPGSSSGNKIPETLPLLN agl6_arath Agamous-like MADS-box protein AGL6 AGL6 At2g45650 F17K2.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVEMKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSVGIESTIERYNRCYNCSLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFETEGHAFKTFQDLWANSAASVAGDPNNSEFPVEPSHPNVLDCNTEPFLQIGFQQHYYVQGEGSSVSKSNVAGETNFVQGWVL agl3_arath Agamous-like MADS-box protein AGL3 AGL3 Protein SEPALLATA 4 SEP4 F19B11.16 At2g03710 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEDSDAALTQSFWGSSAAEQQQQHQQQQQGMSSYQSNPPIQEAGFFKPLQGNVALQMSSHYNHNPANATNSATTSQNVNGFFPGWMV sep1_arath Developmental protein SEPALLATA 1 Agamous-like MADS-box protein AGL2 SEP1 AGL2 At5g15800 F14F8_180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML sep2_arath Developmental protein SEPALLATA 2 Agamous-like MADS-box protein AGL4 SEP2 AGL4 At3g02310 F14P3.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQGNGYIPGWML soc1_arath MADS-box protein SOC1 Protein SUPPRESSOR OF CONSTANS OVEREXPRESSION 1 Agamous-like MADS-box protein AGL20 SOC1 AGL20 At2g45660 F17K2.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFASSNMQDTIDRYLRHTKDRVSTKPVSEENMQHLKYEAANMMKKIEQLEASKRKLLGEGIGTCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEKLSEKWGSHESEVWSNKNQESTGRGDEESSPSSEVETQLFIGLPCSSRK agl14_arath Agamous-like MADS-box protein AGL14 AGL14 Protein XAANTAL 2 XAL2 T26M18.90 At4g11880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSSSIPKTVERYQKRIQDLGSNHKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAENKMLMEKCEMQGRGIIGRISSSSSTSELDIDDNEMEVVTDLFIGPPETRHFKKFPPSN q7x9h6_arath AGL79 AGAMOUS-like 79 At3g30260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRGRVQLRRIENKIRRQVTFSKRRTGLVKKAQEISVLCDAEVALIVFSPKGKLFEYSAGSSMERILDRYERSAYAGQDIPTPNLDSQGECSTECSKLLRMIDVLQRSLRHLRGEEVDGLSIRDLQGVEMQLDTALKKTRSRKNQLMVESIAQLQKKEKELKELKKQLTKKAGEREDFQTQNLSHDLASLATPPFESPHELRRTISPPPPPLSSGDTSQRDGVGEVAAGTLIRRTNATLPHWMPQLTGE q2njq2_aywbp-sep3-1 3264655 N/A 3264682 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-ap1-1 3264656 N/A 3264684 unspecified role unspecified role prey prey Region 87-178 Region 87-178 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl8-1 3264657 N/A 3264685 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sep3-q2njq2_aywbp-1 3264658 N/A 3264683 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264682 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false q2njq2_aywbp-agl12-1 3264659 N/A 3264686 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-flc-1 3264660 N/A 3264687 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-rad23d-1 3264661 N/A 3264688 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-cal-1 3264662 N/A 3264689 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-rad23c-1 3264663 N/A 3264690 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-maf5-1 3264664 N/A 3264691 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl27-1 3264665 N/A 3264692 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl6-1 3264666 N/A 3264693 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-rad23c-2 3264667 N/A 3264690 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl3-1 3264668 N/A 3264694 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-rad23d-2 3264669 N/A 3264688 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region34-124 Region34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl27-2 3264670 N/A 3264695 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264696 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264684 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264692 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264697 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3264683 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association false false false q2njq2_aywbp-sep2-1 3264671 N/A 3264696 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-sep3-2 3264672 N/A 3264682 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3264683 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false q2njq2_aywbp-sep3-3 3264673 N/A 3264682 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl27-3 3264674 N/A 3264692 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-sep1-1 3264675 N/A 3264695 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-ap1-2 3264676 N/A 3264684 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3264683 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false q2njq2_aywbp-agl12-2 3264677 N/A 3264686 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl14-1 3264678 N/A 3264698 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-agl79-1 3264679 N/A 3264699 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q2njq2_aywbp-soc1-1 3264680 N/A 3264697 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3264683 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana physical association physical association false false false q2njq2_aywbp-soc1-2 3264681 N/A 3264697 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3264683 unspecified role unspecified role bait bait Region 34-124 Region 34-124 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false