DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ frielingsdorf-2014-1 cupne cupne Alcaligenes eutrophus Ralstonia eutropha x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Frielingsdorf S., Fritsch J., Schmidt A., Hammer M., Löwenstein J., Siebert E., Pelmenschikov V., Jaenicke T., Kalms J., Rippers Y., Lendzian F., Zebger I., Teutloff C., Kaupp M., Bittl R., Hildebrandt P., Friedrich B., Lenz O., Scheerer P. DIP original experiment: DIP-260980X Nature chemical biology 2014 IMEx Reversible [4Fe-3S] cluster morphing in an O(2)-tolerant [NiFe] hydrogenase. Frielingsdorf S., Fritsch J., Schmidt A., Hammer M., Löwenstein J., Siebert E., Pelmenschikov V., Jaenicke T., Kalms J., Rippers Y., Lendzian F., Zebger I., Teutloff C., Kaupp M., Bittl R., Hildebrandt P., Friedrich B., Lenz O., Scheerer P. Only protein-protein interactions imex curation mbhl_cupnh Uptake hydrogenase large subunit hoxG Hydrogenlyase Membrane-bound hydrogenase large subunit PHG002 protein protein raleh Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) Ralstonia eutropha MSAYATQGFNLDDRGRRIVVDPVTRIEGHMRCEVNVDANNVIRNAVSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGCHALASVRAVENALDIRIPKNAHLIREIMAKTLQVHDHAVHFYHLHALDWVDVMSALKADPKRTSELQQLVSPAHPLSSAGYFRDIQNRLKRFVESGQLGPFMNGYWGSKAYVLPPEANLMAVTHYLEALDLQKEWVKIHTIFGGKNPHPNYLVGGVPCAINLDGIGAASAPVNMERLSFVKARIDEIIEFNKNVYVPDVLAIGTLYKQAGWLYGGGLAATNVLDYGEYPNVAYNKSTDQLPGGAILNGNWDEVFPVDPRDSQQVQEFVSHSWYKYADESVGLHPWDGVTEPNYVLGANTKGTRTRIEQIDESAKYSWIKSPRWRGHAMEVGPLSRYILAYAHARSGNKYAERPKEQLEYSAQMINSAIPKALGLPETQYTLKQLLPSTIGRTLARALESQYCGEMMHSDWHDLVANIRAGDTATANVDKWDPATWPLQAKGVGTVAAPRGALGHWIRIKDGRIENYQCVVPTTWNGSPRDYKGQIGAFEASLMNTPMVNPEQPVEILRTLHSFDPCLACSTHVMSAEGQELTTVKVR mbhs_cupnh Uptake hydrogenase small subunit hoxK Hydrogenlyase Membrane-bound hydrogenase small subunit PHG001 protein protein raleh Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) Ralstonia eutropha MVETFYEVMRRQGISRRSFLKYCSLTATSLGLGPSFLPQIAHAMETKPRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFGVEANADKIGGTASVVVGAAVTAHAAASAIKRASKKNETSGSEH hoxg-hoxk-3 3264647 N/A 3264648 unspecified role unspecified role unspecified role unspecified role Region1-603 Region1-603 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false cupne cupne Alcaligenes eutrophus Ralstonia eutropha N/A 3264649 unspecified role unspecified role unspecified role unspecified role Region 44-360 Region 44-360 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false cupne cupne Alcaligenes eutrophus Ralstonia eutropha direct interaction direct interaction false false false