DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ romano-2014-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. DIP original experiment: DIP-260641X Structure (London, England : 1993) 2014 IMEx Structure and function of RNase AS, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo. Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. Only protein-protein interactions imex curation romano-2014-2 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. DIP original experiment: DIP-260642X Structure (London, England : 1993) 2014 IMEx Structure and function of RNase AS, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo. Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. Only protein-protein interactions imex curation romano-2014-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. DIP original experiment: DIP-260643X Structure (London, England : 1993) 2014 IMEx Structure and function of RNase AS, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo. Romano M., van de Weerd R., Brouwer FC., Roviello GN., Lacroix R., Sparrius M., van den Brink-van Stempvoort G., Maaskant JJ., van der Sar AM., Appelmelk BJ., Geurtsen JJ., Berisio R. Only protein-protein interactions imex curation exrbn_myctu 3'-5' exoribonuclease Rv2179c Rv2179c RVBD_2179c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTDDAGRGAAR exrbn_myctu-1 3264365 N/A 3264368 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false exrbn_myctu-2 3264366 N/A 3264368 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false exrbn_myctu-3 3264367 N/A 3264368 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false