DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ haruta-2014-1 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. DIP original experiment: DIP-265042X Science (New York, N.Y.) 2014 IMEx A peptide hormone and its receptor protein kinase regulate plant cell expansion. Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. Only protein-protein interactions imex curation haruta-2014-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. DIP original experiment: DIP-265044X Science (New York, N.Y.) 2014 IMEx A peptide hormone and its receptor protein kinase regulate plant cell expansion. Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. Only protein-protein interactions imex curation haruta-2014-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. DIP original experiment: DIP-265043X Science (New York, N.Y.) 2014 IMEx A peptide hormone and its receptor protein kinase regulate plant cell expansion. Haruta M., Sabat G., Stecker K., Minkoff BB., Sussman MR. Only protein-protein interactions imex curation feron_arath Receptor-like protein kinase FERONIA FER AAK1 SIR SRN F26O13.190 At3g51550 Protein SIRENE protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKITEGRFRLSLLLLLLLISAATLISAADYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPYMTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQTAEALTYAFIIKEFVVNVEGGTLNMTFTPESAPSNAYAFVNGIEVTSMPDMYSSTDGTLTMVGSSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADPNMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEVSSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVPFHKDYVVNPPEGNGQQDLWLALHPNPVNKPEYYDSLLNGVEIFKMNTSDGNLAGTNPIPGPQVTADPSKVLRPTTRKSKSNTAIIAGAASGAVVLALIIGFCVFGAYRRRKRGDYQPASDATSGWLPLSLYGNSHSAGSAKTNTTGSYASSLPSNLCRHFSFAEIKAATKNFDESRVLGVGGFGKVYRGEIDGGTTKVAIKRGNPMSEQGVHEFQTEIEMLSKLRHRHLVSLIGYCEENCEMILVYDYMAHGTMREHLYKTQNPSLPWKQRLEICIGAARGLHYLHTGAKHTIIHRDVKTTNILLDEKWVAKVSDFGLSKTGPTLDHTHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPALNPTLAKEQVSLAEWAPYCYKKGMLDQIVDPYLKGKITPECFKKFAETAMKCVLDQGIERPSMGDVLWNLEFALQLQESAEENGKGVCGDMDMDEIKYDDGNCKGKNDKSSDVYEGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR rlf1_arath Protein RALF-like 1 RALF1 RALFL1 Rapid alkalinization factor 1 F22D16.10 At1g02900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGGVAWATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS fer-ralf1-1 3262565 N/A 3262568 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3262569 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false Deletion of region 2-8 decreased the interaction rate/strength. fer-ralf1-2 3262566 N/A 3262568 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 28-446 Region 28-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3262569 unspecified role unspecified role prey prey Region 2-8 Region 2-8 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false fer-ralf1-3 3262567 N/A 3262568 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 28-446 Region 28-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3262569 unspecified role unspecified role prey prey Region 2-8 Region 2-8 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false