DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ grishin-2014-1 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. DIP original experiment: DIP-259667X Structure (London, England : 1993) 2014 IMEx NleH defines a new family of bacterial effector kinases. Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. Only protein-protein interactions imex curation grishin-2014-2 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. DIP original experiment: DIP-259668X Structure (London, England : 1993) 2014 IMEx NleH defines a new family of bacterial effector kinases. Grishin AM., Cherney M., Anderson DH., Phanse S., Babu M., Cygler M. Only protein-protein interactions imex curation q8x831_eco57 nleH1-1 ECs_0848 E5F08_07760 protein protein eco57 Escherichia coli O157:H7 MLSPYSVNLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDNGAQVKVGNRTYRVVATDNKFCVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNASPVSAAMERGIVHSNRPDLPPVDYAPPELPSVDYNRLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQYYGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRAKNEFNPIDISSYNVSDRSWSESQIMQSYHGGKQDLISVVLSKI q8xal6_eco57 E5F08_14920 nleH1_2 ECs_1814 protein protein eco57 Escherichia coli O157:H7 MLSPSSINLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDSGTQVTVGNRTYRVVVTDNKFCVTRESHSGCFTNLLHRLGWPKGEISRKIEAMLNTSPVSTTIERGSVHSNRPDLPPVDYAQPELPPADYTQSELPRVSNNKSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEVTSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRLEKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVLSKI q8x831_eco57-1 3261761 N/A 3261763 putative self putative self unspecified role unspecified role Region 40-293 Region 40-293 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false q8xal6_eco57-1 3261762 N/A 3261764 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false