DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dowling-2014-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dowling DP., Bruender NA., Young AP., McCarty RM., Bandarian V., Drennan CL. DIP original experiment: DIP-260176X Nature chemical biology 2014 IMEx Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism. Dowling DP., Bruender NA., Young AP., McCarty RM., Bandarian V., Drennan CL. Only protein-protein interactions imex curation dowling-2014-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dowling DP., Bruender NA., Young AP., McCarty RM., Bandarian V., Drennan CL. DIP original experiment: DIP-260177X Nature chemical biology 2014 IMEx Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism. Dowling DP., Bruender NA., Young AP., McCarty RM., Bandarian V., Drennan CL. Only protein-protein interactions imex curation quee_burm1 7-carboxy-7-deazaguanine synthase queE Queuosine biosynthesis protein QueE BMULJ_00116 Bmul_3115 protein protein burm1 Burkholderia multivorans (strain ATCC 17616 / 249) MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP quee-1 3294679 N/A 3294681 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false quee-2 3294680 N/A 3294681 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false