DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ polle-2014-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259637X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259641X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259635X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259643X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259639X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259644X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259638X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259642X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-9 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259636X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-10 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259640X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation polle-2014-11 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. DIP original experiment: DIP-259645X Structure (London, England : 1993) 2014 IMEx Structural details of human tuba recruitment by InlC of Listeria monocytogenes elucidate bacterial cell-cell spreading. Polle L., Rigano LA., Julian R., Ireton K., Schubert WD. Only protein-protein interactions imex curation inlc_lismg Internalin C Internalin-related protein A irpA inlC protein protein lismg Listeria monocytogenes serotype 1/2a MLKKNNWLQNAVIAMLVLIVGLCINMGSGTKVQAESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN q6xzf7-1 Dynamin-binding protein ARHGEF36 TUBA DNMBP KIAA1010 Scaffold protein Tuba protein protein human Homo sapiens Human MEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVTIPSLKEGERLFVCICEFTSQELDNLPLHRGDLVILDGIPTAGWLQGRSCWGARGFFPSSCVRELCLSSQSRQWHSQSALFQIPEYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEPGWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGNQDDCIVNGEVDTPVGEEEIGPDEDEEEPGTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLCPDTRVEETMALPQEGSLARIPETSLDCLENTLGVEEQRHETSDHEAEEPDCIISEAPTSPLGHLTSEYDTDRNSYQDEDTAGGPPRSPGVEWEMPLATDSPTSDPTEVVNGISSQPQVPFHPNLQKSQYYSTVGGSHPHSEQYPDLLPLEARTRDYASLPPKRMYSQLKTLQKPVLPLYRGSSVSASRVVKPRQSSPQLHNLASYTKKHHTSSVYSISERLEMKPGPQAQGLVMEAATHSQGDGSTDLDSKLTQQLIEFEKSLAGPGTEPDKILRHFSIMDFNSEKDIVRGSSKLITEQELPERRKALRPPPPRPCTPVSTSPHLLVDQNLKPAPPLVVRPSRPAPLPPSAQQRTNAVSPKLLSRHRPTCETLEKEGPGHMGRSLDQTSPCPLVLVRIEEMERDLDMYSRAQEELNLMLEEKQDESSRAETLEDLKFCESNIESLNMELQQLREMTLLSSQSSSLVAPSGSVSAENPEQRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQLLAALEISDAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED q03173-1 Protein enabled homolog Enah Mena Ndpp1 Neural variant Mena+++ 140 kDa isoform NPC-derived proline-rich protein 1 protein protein mouse Mus musculus Mouse MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAAQSKVTATQDSTNLRCIFCGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERMERERLERERLERERLERERLEQEQLERQRQEREHVERLERERLERLERERQERERERLEQLEREQVEWERERRMSNAAPSSDSSLSSAPLPEYSSCQPPSAPPPSYAKVISAPVSDATPDYAVVTALPPTSTPPTPPLRHAATRFATSLGSAFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPPAAKSCAWPTSNFSPLPPSPPIMISSPPGKATGPRPVLPVCVSSPVPQMPPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSPSAGAPASAETPLNPELGDSSASEPGLQAASQPAESPTPQGLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDNRPLTGLAAAIAGAKLRKVSRVEDGSFPGGGNTGSVSLASSKADAGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPSSQPSANGVQTEGLDYDRLKQDILDEMRKELAKLKEELIDAIRQELSKSNTA dnmbp-inlc-1 3261009 N/A 3261020 unspecified role unspecified role unspecified role unspecified role Region 34-296 Region 34-296 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-inlc-2 3261010 N/A 3261020 unspecified role unspecified role unspecified role unspecified role Region 35-297 Region 35-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-wasl-1 3261011 N/A 3261022 unspecified role unspecified role unspecified role unspecified role Region 346-357 Region 346-357 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-inlc-3 3261012 N/A 3261020 unspecified role unspecified role prey prey Region 35-297 Region 35-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P71451:p.Phe146Ala F146A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role bait bait Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-enah-1 3261013 N/A 3261023 unspecified role unspecified role unspecified role unspecified role Region 547-558 Region 547-558 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-inlc-4 3261014 N/A 3261020 unspecified role unspecified role unspecified role unspecified role Region 35-297 Region 35-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P71451:p.Phe146Ala F146A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-wasl-2 3261015 N/A 3261022 unspecified role unspecified role unspecified role unspecified role Region 346-357 Region 346-357 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-inlc-5 3261016 N/A 3261020 unspecified role unspecified role prey prey Region 35-297 Region 35-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role bait bait Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6XZF7-1:p.Val1521Arg V1521R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q6XZF7-1:p.Asn1569Arg N1569R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-enah-2 3261017 N/A 3261023 unspecified role unspecified role unspecified role unspecified role Region 547-558 Region 547-558 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-inlc-6 3261018 N/A 3261020 unspecified role unspecified role unspecified role unspecified role Region 35-297 Region 35-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q6XZF7-1:p.Val1521Arg V1521R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q6XZF7-1:p.Asn1569Arg N1569R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dnmbp-1 3261019 N/A 3261021 unspecified role unspecified role unspecified role unspecified role Region 1513-1577 Region 1513-1577 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false