DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ loose-2014-1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Loose M., Mitchison TJ. DIP original experiment: DIP-260066X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Loose M., Mitchison TJ. Only protein-protein interactions imex curation loose-2014-2 in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260069X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Loose M., Mitchison TJ. Only protein-protein interactions imex curation loose-2014-3 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Loose M., Mitchison TJ. DIP original experiment: DIP-260067X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Loose M., Mitchison TJ. Only protein-protein interactions imex curation loose-2014-4 in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260070X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Loose M., Mitchison TJ. Only protein-protein interactions imex curation loose-2014-5 in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Loose M., Mitchison TJ. DIP original experiment: DIP-260068X Nature cell biology 2014 IMEx The bacterial cell division proteins FtsA and FtsZ self-organize into dynamic cytoskeletal patterns. Loose M., Mitchison TJ. Only protein-protein interactions imex curation ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD zipa_ecoli Cell division protein ZipA zipA FtsZ interacting protein A JW2404 b2412 protein protein ecoli Escherichia coli (strain K12) MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA ftsa-ftsz-5 3260814 N/A 3260819 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260820 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftsz-ftsz-5 3260815 N/A 3260820 unspecified role unspecified role unspecified role unspecified role Cy5-label Cy5-label cy5 label cy5 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3260820 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ftsz-zipa-2 3260816 N/A 3260821 unspecified role unspecified role unspecified role unspecified role Region 23-328 Region 23-328 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260820 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ftsa-ftsz-6 3260817 N/A 3260819 unspecified role unspecified role unspecified role unspecified role Cy5-label Cy5-label cy5 label cy5 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3260820 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ftsz-2 3260818 N/A 3260820 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false