DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ leyrat-2014-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. DIP original experiment: DIP-259630X Structure (London, England : 1993) 2014 IMEx Structure and self-assembly of the calcium binding matrix protein of human metapneumovirus. Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. Only protein-protein interactions imex curation leyrat-2014-2 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. DIP original experiment: DIP-259631X Structure (London, England : 1993) 2014 IMEx Structure and self-assembly of the calcium binding matrix protein of human metapneumovirus. Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. Only protein-protein interactions imex curation leyrat-2014-3 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. DIP original experiment: DIP-259632X Structure (London, England : 1993) 2014 IMEx Structure and self-assembly of the calcium binding matrix protein of human metapneumovirus. Leyrat C., Renner M., Harlos K., Huiskonen JT., Grimes JM. Only protein-protein interactions imex curation q91f56_9mono Matrix protein M protein protein human metapneumovirus Human metapneumovirus MESYLVDTYQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQNGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKSVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR m-6 3260775 N/A 3260778 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false m-7 3260776 N/A 3260778 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false m-8 3260777 N/A 3260778 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false