DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yamamoto-2014-11 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266679X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation yamamoto-2014-12 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266681X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation yamamoto-2014-13 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266684X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation yamamoto-2014-14 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266680X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation yamamoto-2014-15 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266682X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation yamamoto-2014-16 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. DIP original experiment: DIP-266683X Molecular immunology 2014 IMEx Functional assessment of the mutational effects of human IRAK4 and MyD88 genes. Yamamoto T., Tsutsumi N., Tochio H., Ohnishi H., Kubota K., Kato Z., Shirakawa M., Kondo N. Only protein-protein interactions imex curation p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL q99836-1 Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS myd88-tirap-5 3260733 N/A 3260739 unspecified role unspecified role prey prey Region 75-235 Region 75-235 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260740 unspecified role unspecified role bait bait Region 148-296 Region 148-296 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q99836-1:p.Arg196Cys R196C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false myd88-1 3260734 N/A 3260740 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false irak4-myd88-12 3260735 N/A 3260741 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9NWZ3:p.Arg12Cys R12C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9NWZ3:p.Arg20Trp R20W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260740 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false irak4-myd88-13 3260736 N/A 3260741 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9NWZ3:p.Arg12Cys R12C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9NWZ3:p.Arg20Trp R20W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260740 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false irak4-1 3260737 N/A 3260741 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false irak4-myd88-14 3260738 N/A 3260741 unspecified role unspecified role unspecified role unspecified role Region 1-150 Region 1-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3260740 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q99836-1:p.Arg98Cys R98C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false