DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2014-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. DIP original experiment: DIP-259858X Nature 2014 IMEx Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA. Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. Only protein-protein interactions imex curation zhou-2014-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. DIP original experiment: DIP-259857X Nature 2014 IMEx Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA. Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. Only protein-protein interactions imex curation zhou-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. DIP original experiment: DIP-259859X Nature 2014 IMEx Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA. Zhou L., Hang J., Zhou Y., Wan R., Lu G., Yin P., Yan C., Shi Y. Only protein-protein interactions imex curation lsm8_yeast U6 snRNA-associated Sm-like protein LSm8 LSM8 J1464 YJR83.16 YJR022W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK B6E37F585B6292EA lsm7_yeast U6 snRNA-associated Sm-like protein LSm7 LSM7 N1202 N1780 YNL147W protein protein yeast Saccharomyces cerevisiae Baker's yeast MHQQHSKSENKPQQQRKKFEGPKREAILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNARKLGLTVIRGTILVSLSSAEGSDVLYMQK EA1D019FC5D1B5C5 lsm6_yeast U6 snRNA-associated Sm-like protein LSm6 LSM6 D9481.18 YDR378C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI 74FE40A4509CEF33 lsm5_yeast U6 snRNA-associated Sm-like protein LSm5 LSM5 YER146W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL 84E8A1E8E2F078FE lsm4_yeast U6 snRNA-associated Sm-like protein LSm4 LSM4 SDB23 USS1 YER112W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQINSNNNSNSNGPGHKRYYNNRDSNNNRGNYNRRNNNNGNSNRRPYSQNRQYNNSNSSNINNSINSINSNNQNMNNGLGGSVQHHFNSSSPQKVEF 69CAC1F01D5BFA98 lsm3_yeast U6 snRNA-associated Sm-like protein LSm3 LSM3 SMX4 USS2 YLR438C-A SmX4 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTPSEDDDGAVEI 787084EF6A5945B7 lsm2_yeast U6 snRNA-associated Sm-like protein LSm2 LSM2 Small nuclear ribonucleoprotein D homolog SNP3 SMX5 SNP3 YBL0425 YBL026W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK C23856268CEE92E2 lsm2-lsm3-21 3260040 N/A 3260043 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260044 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260045 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false lsm2-lsm3-22 3260041 N/A 3260043 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260044 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260045 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false lsm2-lsm3-23 3260042 N/A 3260043 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260044 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260045 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260046 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3260049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli association association false false false