DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kingsley-2013-1 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. DIP original experiment: DIP-255872X Structure (London, England : 1993) 2013 IMEx Preferential and specific binding of human αB-crystallin to a cataract-related variant of γS-crystallin. Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. Only protein-protein interactions imex curation kingsley-2013-2 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. DIP original experiment: DIP-255873X Structure (London, England : 1993) 2013 IMEx Preferential and specific binding of human αB-crystallin to a cataract-related variant of γS-crystallin. Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. Only protein-protein interactions imex curation kingsley-2013-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. DIP original experiment: DIP-255874X Structure (London, England : 1993) 2013 IMEx Preferential and specific binding of human αB-crystallin to a cataract-related variant of γS-crystallin. Kingsley CN., Brubaker WD., Markovic S., Diehl A., Brindley AJ., Oschkinat H., Martin RW. Only protein-protein interactions imex curation cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK AE08BED46B7849CB crygs_human Gamma-crystallin S Beta-crystallin S CRYGS CRYG8 Gamma-S-crystallin protein protein human Homo sapiens Human MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE cryab-15 3259783 N/A 3259786 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cryab-crygs-1 3259784 N/A 3259787 unspecified role unspecified role unspecified role unspecified role P22914:p.Gly18Val G18V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259786 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cryab-crygs-2 3259785 N/A 3259787 unspecified role unspecified role unspecified role unspecified role P22914:p.Gly18Val G18V mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259786 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false