DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2013-9 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259711X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-10 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259709X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-11 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259715X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-12 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259713X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-13 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259712X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-14 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259710X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation zhao-2013-15 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. DIP original experiment: DIP-259714X PLoS biology 2013 IMEx A bipartite molecular module controls cell death activation in the Basal cell lineage of plant embryos. Zhao P., Zhou XM., Zhang LY., Wang W., Ma LG., Yang LB., Peng XB., Bozhkov PV., Sun MX. Only protein-protein interactions imex curation t2bru3_tobac CP8 LOC107825148 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MELGKIFLISVLLPMAFGLVQSLEFTEKDIASEESLWDLYQRWRSHHTVSRDLSEKQKRFNVFKANVMHVHKVNKMDRPYKLKLNEFAAMTNHEFRNFYSSKVKHFRMLHGSRPTTGFMHDKADNLPASIDWRKQGAVTGVKNQGKCGSCWAFSAVVGVEGINKIKTGQLVSLSEQELVDCEKDNEGCNGGLMENAYEFIKKNGGITTEGIYPYRARDSRCDSSKMNSPVVNIDGHEMVPTNDEDALMKAVANQPVSVAIDASGSDLQFYSEGVFNGNCGTELDHGVAVVGYGATHDGTKYWIVKNSWGTGWGEQGYFRMERGIDAGEGLCGIAMEASYPLKLSSDNPKPAPSKDEL t2brr7_tobac CYS protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAFKINSFLLMTLSIVVIASIFCHVSAANDGRKLLDSSDLVSNTPALSQLFGDWQPIKDAKDPKVVKVGEFAVDAYNRISNSFPLTFESVLGGQFQVVNGITYKLVISARQNVTTTNYLAVVNEHSGDNVKTLISFEKFA o24137_tobac protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAKTIITTLLFALFSSLSYAIDMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALGEKEKRFEIFKDNLRFIEGHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAVEGINQIVTGEMITLSEQELVDCDRVQNSGCNGGLMDYAFEFIISNGGMDTEKHYPYRGVEGRCDPVRKNYKVVSIDGYEDVPRNERALQKAVAHQPVCVAIEASGRAFQLYSSGVFTGECGEEVDHGVVVVGYGSEDGVDYWIVRNSWGTKWGENGYVKMERNVKKSHLGKCGIMTEASYPTKDSAINKRNTSKEEKISSI t2bra8_tobac CP14 LOC107815488 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MGSIQIPYRHFLLLPLFLILAALYSQVSAFTTDFPILDRPTEFLSEERVFQLFQEWKQRHGKVYKNEKEEEMRLDKFKRNVKYIVEKNSKKKSDSDHFVGLTKFADMSNEEFRQVHTSNIKIPFNKRKTIQMRSVERKPSTASCDVPPSKDWRKHGAVTEVKNQDQCGACWAFSACGAMEGINAIATGELISLSEQELINCDNSYNTGCDGGLMDPAFEWVMNNSGINSEADYPYTASQGRCNYDKVNHKVVIIDGYQDVPEDENALLCAVGQQPVSVGIDGSSLDFQLYRGGIYDGECSSNPDDLSHAVVIVGYGSEGDDDYWIIKNSWGTSWGMEGYAYIRRNTYLPYGVCAINSLASYPTKEASSAPSPYPSPAVPPPPPPSPPPPPPPSPKPSECGEFYYCPEDQTCCCELYFFGICFIQGCCPYENGVCCHGSEFCCPADYPICDVYEGLCLKDYRDNIGVAARKRRMAKHKLPWRANTEATEERDQTLKWKRNHVAAMR t2bq67_tobac CP15 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAIHTSTLSISILVMLMFSVVSSSAAEDMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALGEKDKRFQIFKDNLRYIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSDRYAPKVGDSLPDSVDWRKKGVLVDVKNQGQCGSCWAFSAVASIEAVNKIMTGNLISLSEQELVDCDTADNQGCQGGLMDDAFKFVIQNGGIDTEEDYPYKAKDGKCDQARKNAKVVTIDGYEDVPANDEKALKKAVAGQPVSVAIEAGGKDFQHYKSGIFTGKCGAAVDHGVVAVGYGSENGMDYWIVRNSWGASWGENGYLRMQRNIGNPKGLCGIATIASYPVKTGQNPPKPAPSPPSPVKPPTQCDDYNECPAGTTCCCVYKYYNYCFAWGCCPMEGATCCKDHNSCCPHDYPVCNVKAGTCSISKNNPLGVKAMQHILAKPIGTFGNEGKKSPSS t2bru8_tobac CP6 LOC107781604 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MATLSFTLTISLLLLLFLFFSTLSSASDMSILTYDENQHFRTDDEVMSLYESWLVEHGKSYNALDEKDKRFQIFKENLRYIDEQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSDRYLPKVGDSLPDSVDWREKGVLVGVKDQGSCGSCWAFSAIASVEAVNSIVTGDVISLSEQELVDCDTSYNDGCNGGLMDYAFDFIIKNGGIDTEEDYPYTGRDGRCDQSRKNAKVVTINGYEDVPENNEKALQKAVASQPVSIAIEAGGKDFQHYVSGIFTGKCGTAVDHGVVAVGYGSENGMDYWIIRNSWGASWGEKGYLRVQRNVASSKGLCGLAIEPSYPVKTGVNPPKPSPSPPSPIKPPTQCDDYAQCPEGTTCCCVFEYYNSCFSWGCCPLEGATCCEDHYSCCPHDYPVCNVRAGTCSISKNNPLGVKAMKHILAEPIGAFINGGKKSSS q9lri2_tobac NTCP-23 LOC107784768 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MSRFSLLLALVVAGGLFASALAGPATFADENPIRQVVSDGLHELENAILQVVGKTRHALSFARFAHRYGKRYESVEEIKQRFEVFLDNLKMIRSHNKKGLSYKLGVNEFTDLTWDEFRRDRLGAAQNCSATTKGNLKVTNVVLPETKDWREAGIVSPVKNQGKCGSCWTFSTTGALEAAYSQAFGKGISLSEQQLVDCAGAFNNFGCNGGLPSQAFEYIKSNGGLDTEEAYPYTGKNGLCKFSSENVGVKVIDSVNITLGAEDELKYAVALVRPVSIAFEVIKGFKQYKSGVYTSTECGNTPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYPVVA cp8-cys-1 3258804 N/A 3258811 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false cys-o24137_tobac-1 3258805 N/A 3258813 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false cp14-cys-1 3258806 N/A 3258814 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana physical association physical association false false false cp15-cys-1 3258807 N/A 3258815 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false cp14-cys-2 3258808 N/A 3258814 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false cp6-cys-1 3258809 N/A 3258816 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false cys-ntcp_23-1 3258810 N/A 3258817 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3258812 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false