DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2013-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264993X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265004X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265003X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264994X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264999X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265000X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-22 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265005X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264995X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-24 allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265006X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-25 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264996X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-26 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265001X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-27 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264997X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-28 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-265002X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation lee-2013-29 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. DIP original experiment: DIP-264998X Science (New York, N.Y.) 2013 IMEx Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Lee JH., Ryu HS., Chung KS., Posé D., Kim S., Schmid M., Ahn JH. Only protein-protein interactions imex curation svp_arath MADS-box protein SVP Protein SHORT VEGETATIVE PHASE SVP F14M13.6 At2g22540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSSSMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENERLGMQICNNVHAHGGAESENAAVYEEGQSSESITNAGNSTGAPVDSESSDTSLRLGLPYGG q9at76-1 Agamous-like MADS-box protein AGL27 AGL27 FK1 FLM MAF1 MADS box FLC1-like nuclear protein Protein FLOWERING LOCUS M Protein MADS AFFECTING FLOWERING 1 F22K20.15 At1g77080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSGDDISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQMGKNTLLATDDERGMFPGSSSGNKIPETLPLLN vcs_arath Enhancer of mRNA-decapping protein 4 VCS EDC4 Protein VARICOSE MDC11.13 At3g13300 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSPGNTNPHNTPPFDLGILFKPSSNPYPPPAASYPPPTGPFLHNQYDQQHYAPPGISAQPSPVTQQQQDVSSSSAATNLHPQRTLSYPTPPLNLQSPRSNHNPGTHILALLNNTNNGAPVANQEPSHQLPVVNHNEIARSFPGGSGPIRVPSCKLPKGRRLIGEHAVYDVDVRLQGEIQPQLEVTPITKYGSDPQLVVGRQIAVNKVYICYGLKGGNIRVLNINTALRSLFRGHSQRVTDMAFFAEDVDMLASVSLDGKVFVWKISEGSEGEDQPQITGKIVLALQILGEEDTKHPRVCWHCHKQEILVVSIGKHVLRIDTTKVGRGEVFSAEAPLQCPLDKLIDGVQIVGKHDGEVTDLSMCQWMTTRLVSSSVDGTIKIWQDRKAQPLVVLRPHDGHPVSSATFVTSPERPDHIILITGGPLNREMKIWVSAGEEGWLLPADAESWRCTQTLDLKSSTEPRAEEAFFNQVIALSEAGLLLLANAKRNALYAVHLDYGSSPVGTRMDYLSEFTVTMPILSFIGTNDPPEEPIVKVYCVQTLAIQQYTLDLCLCLPPPIENMGLEKSDSSVSREANLVEGMSEPSGLKPTDLPSVDSVPKPSIIVNRSESANKLSFPSAEATSQAIVPPNGEPKTSGLPSQTSGAGSAYATLPQLPLSPRLSSKLSGYHTPVEAIEPVIPHHELGGKTPSADYSVDRQMDAVGERNLDVSSVEEISRSKDSNVTPDDDVSGMRSPSAFFKHPTHLVTPSEILMGVSSAEASITTEDRRDRDANIQDVNNDPRDTEVEVKEISEARSTQNGEINDHDETENCTSENREKVFCSQVSNLSTEMARDCYPSTEGTFIPGESKAYGQPIKAGDESGVDSRGGPAKLLKGKKQKAKNSQGPGLSSTSSNVANLADSFNEQSQSLSHPMTDLLPQLLAMQETMNQVMASQKEMQRQLSNAATGPIGKESKRLEVALGRMIEKSSKSNADALWARIQEETVKNEKALRDHAQQIVNATTNFMSKELNAMFEKTIKKELAAIGPALARSVVPVIEKTVSSAITESFQRGIGDKAVNQLDKSVNIKLEATVARQIQAQFQTSGKQALQEGLRSSVESSVIPSFEKACKAMFDQIDSAFQKGIAEHTNAAQQRFDSGHSQLAHTLKESITSASSVAQALSRELAETQRNLLALAAAGANSGGSNSLVTQLSGGPLGALLEKVEAPMDPTTELSRLISERKYEESFTSALQRSDVSIVSWLCSQVDLRGLLAMNPLPLSQGVLLSLLQQLACDISKDTSRKLAWMTDVVAAINPSDQMIAVHARPIFEQVYQILHHHRNAPGSDVSAIRLIMHVINSMLMGCK mint mip1_arath MND1-interacting protein 1 At1g32530 MIP1 F5D14.31 T9G5.5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVENLVYHPGLTDSGSVNLNSVTENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHCYGELDVLTNIVNNSLSYLNSGGGGGGSNGNGEDRTETGFTDLRDLEEYSLAGMIYLLQQVKPNLSKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAGFMAPALCRFHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRNVAAFAAGYRASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEESVSTVLEKFRDLNLDDNLESVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVSEELAELKTLSSEREGIQLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLENQNAEIRAEREGSKLSASESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIELDFQRHKDDHQRLEQELGRLKASSDSDSSHISNNAWKPKKSQGENIAKLLEEIDKLEGSYDNEANYDRECIICMKDEVSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGLVQQRIRIFGATS tsa1_arath TSK-associating protein 1 TSA1 F19K6.14 At1g52410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEIYTMKTNFLVLALSLCILLSSFHEVSCQDDGSGLSNLDLIERDYQDSVNALQGKDDEDQSAKIQSENQNNTTVTDKNTISLSLSDESEVGSVSDESVGRSSLLDQIKLEFEAHHNSINQAGSDGVKAESKDDDEELSAHRQKMLEEIEHEFEAASDSLKQLKTDDVNEGNDEEHSAKRQSLLEEIEREFEAATKELEQLKVNDFTGDKDDEEHSAKRKSMLEAIEREFEAAMEGIEALKVSDSTGSGDDEEQSAKRLSMLEEIEREFEAASKGLEQLRASDSTADNNEEEHAAKGQSLLEEIEREFEAATESLKQLQVDDSTEDKEHFTAAKRQSLLEEIEREFEAATKDLKQLNDFTEGSADDEQSAKRNKMLEDIEREFEAATIGLEQLKANDFSEGNNNEEQSAKRKSMLEEIEREFEAAIGGLKQIKVDDSRNLEEESAKRKIILEEMEREFEEAHSGINAKADKEESAKKQSGSAIPEVLGLGQSGGCSCSKQDEDSSIVIPTKYSIEDILSEESAVQGTETSSLTASLTQLVENHRKEKESLLGHRVLTSPSIASSTSESSATSETVETLRAKLNELRGLTARELVTRKDFGQILITAASFEELSSAPISYISRLAKYRNVIKEGLEASERVHIAQVRAKMLKEVATEKQTAVDTHFATAKKLAQEGDALFVKIFAIKKLLAKLEAEKESVDGKFKETVKELSHLLADASEAYEEYHGAVRKAKDEQAAEEFAKEATQSAEIIWVKFLSSL anxd1_arath Annexin D1 ANN1 ANNAT1 ANX23-ATH ATOXY5 OXY5 AnnAt1 Annexin A1 F14D7.2 At1g35720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFLALLRSTIQCLTRPELYFVDVLRSAINKTGTDEGALTRIVTTRAEIDLKVIGEEYQRRNSIPLEKAITKDTRGDYEKMLVALLGEDDA di191_arath Protein DEHYDRATION-INDUCED 19 DI19-1 At1g56280 DI19 F14G9.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDADSKRFLATLRSRSEMLMGFEEIDGDDDFQEEFACPFCAESYDIIGLCCHIDDEHTLESKNAVCPVCSLKVGVDIVAHITLHHGSLFKLQRKRKSRKSGTNSTLSLLRKELREGDLQRLLGFTSRNGSVASSVTPDPLLSSFISPTRSQSSPAPRQTKNVSEDKQIERKRQVFISPVSLKDREERRHKSEFVQRLLSSAIFDEV agl27-svp-1 3258366 N/A 3258380 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false svp-svp-1 3258367 N/A 3258380 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258380 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-agl27-1 3258368 N/A 3258381 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-svp-2 3258369 N/A 3258380 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-vcs-1 3258370 N/A 3258382 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-mip1-1 3258371 N/A 3258383 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false svp-agl27-1 3258372 N/A 3258380 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3258381 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false svp-agl27-2 3258373 N/A 3258380 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-svp-3 3258374 N/A 3258380 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false allce Allium cepa (Onion) Onion N/A 3258381 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false allce Allium cepa (Onion) Onion physical association physical association false false false agl27-tsa1-1 3258375 N/A 3258384 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false svp-agl27-3 3258376 N/A 3258380 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3258381 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false agl27-ann1-1 3258377 N/A 3258385 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false agl27-svp-4 3258378 N/A 3258380 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3258381 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false agl27-di19_1-1 3258379 N/A 3258386 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3258381 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false