DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ludwig-2012-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254701X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254686X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254689X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-4 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254708X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254696X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254692X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254702X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254700X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254690X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254697X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-11 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254705X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254693X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254687X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254688X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254691X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-16 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254704X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-17 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254694X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-18 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254698X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-19 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254707X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-20 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254706X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-21 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254695X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-22 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254699X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-23 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254703X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation ludwig-2012-24 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. DIP original experiment: DIP-254709X PLoS biology 2012 IMEx Molecular composition and ultrastructure of the caveolar coat complex. Ludwig A., Howard G., Mendoza-Topaz C., Deerinck T., Mackey M., Sandin S., Ellisman MH., Nichols BJ. Only protein-protein interactions imex curation cavn3_human Caveolae-associated protein 3 CAVIN3 Cavin-3 PRKCDBP Protein kinase C delta-binding protein SRBC Serum deprivation response factor-related gene product that binds to C-kinase protein protein human Homo sapiens Human MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA cavn1_human Caveolae-associated protein 1 CAVIN1 Cavin-1 PTRF Polymerase I and transcript release factor FKSG13 protein protein human Homo sapiens Human MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD cavn2_human Caveolae-associated protein 2 CAVIN2 Cavin-2 PS-p68 Phosphatidylserine-binding protein SDPR Serum deprivation-response protein protein protein human Homo sapiens Human MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQVHQTS cav2_human Caveolin-2 CAV2 protein protein human Homo sapiens Human MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI cavn1_mouse Caveolae-associated protein 1 Cavin1 Cav-p60 Cavin-1 Polymerase I and transcript release factor Ptrf protein protein mouse Mus musculus Mouse MEDVTLHIVERPYSGFPDASSEGPEPTQGEARATEEPSGTGSDELIKSDQVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSVSKSLKESEALPEKEGDELGEGERPEDDTAAIELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPVERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGEVEVLKATEMVEVGPEDDEVGAERGEATDLLRGSSPDVHTLLEITEESDAVLVDKSDSD cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI prkcdbp-ptrf-3 3257935 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false cav1-cav2-1 3257936 N/A 3257959 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257961 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257962 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false ptrf-cav1-1 3257937 N/A 3257959 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257961 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false ptrf-prkcdbp-1 3257938 N/A 3257959 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257964 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false sdpr-ptrf-1 3257939 N/A 3257961 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false sdpr-cav1-1 3257940 N/A 3257961 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false ptrf-cav1-2 3257941 N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false cav1-ptrf-7 3257942 N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false sdpr-cav1-2 3257943 N/A 3257959 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257961 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false ptrf-ptrf-3 3257944 N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false ptrf-cav1-3 3257945 N/A 3257965 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257964 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257961 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false prkcdbp-cav1-1 3257946 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false cav1-ptrf-8 3257947 N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false cav1-prkcdbp-3 3257948 N/A 3257959 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257961 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false prkcdbp-cav1-2 3257949 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257961 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false cav1-prkcdbp-4 3257950 N/A 3257959 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false ptrf-cav1-4 3257951 N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false prkcdbp-cav1-3 3257952 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false ptrf-cav1-5 3257953 N/A 3257959 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257965 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257964 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false ptrf-ptrf-4 3257954 N/A 3257964 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257961 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257960 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse association association false false false sdpr-cav1-3 3257955 N/A 3257961 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false prkcdbp-ptrf-4 3257956 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257960 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false prkcdbp-cav1-4 3257957 N/A 3257959 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3257963 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false sdpr-cav1-4 3257958 N/A 3257961 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257959 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3257965 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3257964 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false