DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chung-2013-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266817X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions imex curation chung-2013-2 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266818X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions imex curation chung-2013-3 ecolx Escherichia coli crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266819X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions imex curation chung-2013-4 ecolx Escherichia coli crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. DIP original experiment: DIP-266820X Science (New York, N.Y.) 2013 IMEx Crystal structure of MraY, an essential membrane enzyme for bacterial cell wall synthesis. Chung BC., Zhao J., Gillespie RA., Kwon DY., Guan Z., Hong J., Zhou P., Lee SY. Only protein-protein interactions imex curation mray_aquae Phospho-N-acetylmuramoyl-pentapeptide-transferase mraY UDP-MurNAc-pentapeptide phosphotransferase aq_053 protein protein aquae Aquifex aeolicus (strain VF5) MLYQLALLLKDYWFAFNVLKYITFRSFTAVLIAFFLTLVLSPSFINRLRKIQRLFGGYVREYTPESHEVKKYTPTMGGIVILIVVTLSTLLLMRWDIKYTWVVLLSFLSFGTIGFWDDYVKLKNKKGISIKTKFLLQVLSASLISVLIYYWADIDTILYFPFFKELYVDLGVLYLPFAVFVIVGSANAVNLTDGLDGLAIGPAMTTATALGVVAYAVGHSKIAQYLNIPYVPYAGELTVFCFALVGAGLGFLWFNSFPAQMFMGDVGSLSIGASLATVALLTKSEFIFAVAAGVFVFETISVILQIIYFRWTGGKRLFKRAPFHHHLELNGLPEPKIVVRMWIISILLAIIAISMLKLR mray-1 3257542 N/A 3257546 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mray-2 3257543 N/A 3257546 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mray-3 3257544 N/A 3257546 unspecified role unspecified role unspecified role unspecified role O66465:p.[Thr23Cys;Ser354Cys] T23C/S354C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false mray-4 3257545 N/A 3257546 unspecified role unspecified role unspecified role unspecified role O66465:p.[Trp253Cys;Arg340Cys] W253C/R340C mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false