DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ abascal_palacios-2013-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255741X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255737X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255744X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255747X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-5 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255751X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255738X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255742X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255748X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-9 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255750X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-10 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255745X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255739X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-12 human Homo sapiens Human pull down pull down western blot western blot Immuno blot Immuno blot Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255749X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-13 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255746X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-14 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255743X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation abascal_palacios-2013-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. DIP original experiment: DIP-255740X Structure (London, England : 1993) 2013 IMEx Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6. Abascal-Palacios G., Schindler C., Rojas AL., Bonifacino JS., Hierro A. Only protein-protein interactions imex curation o60499-1 Syntaxin-10 STX10 SYN10 protein protein human Homo sapiens Human MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL q9uid3-1 Vacuolar protein sorting-associated protein 51 homolog VPS51 ANG2 C11orf2 C11orf3 FFR Another new gene 2 protein Protein fat-free homolog PP5382 protein protein human Homo sapiens Human MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDPTDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRYQGRAQAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRLEKELRNLEAELGPSPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFHRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLGCLTDVRQALAAPRVAGKEGPGLAELLANVASSILSHIKASLAAVHLFTAKEVSFSNKPYFRGEFCSQGVREGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATISYILTLTDEQFLVQDQFPVTPVSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDWLSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYEEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKVSVLTGIIKISLKTLLECVRLRTFGRFGLQQVQVDCHFLQLYLWRFVADEELVHLLLDEVVASAALRCPDPVPMEPSVVEVICERG vamp4_human Vesicle-associated membrane protein 4 VAMP4 protein protein human Homo sapiens Human MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT stx6_human Syntaxin-6 STX6 protein protein human Homo sapiens Human MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLILFLVL vps52_human Vacuolar protein sorting-associated protein 52 homolog SACM2L SAC2 suppressor of actin mutations 2-like protein VPS52 protein protein human Homo sapiens Human MAAAATMAAAARELVLRAGTSDMEEEEGPLAGGPGLQEPLQLGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVEDTAKKGFFSKPSLRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQRYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEFSSALVSINQTIPNERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERGQAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF vti1a_human Vesicle transport through interaction with t-SNAREs homolog 1A VTI1A Vesicle transport v-SNARE protein Vti1-like 2 Vti1-rp2 protein protein human Homo sapiens Human MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH vps51-stx10-1 3256473 N/A 3256488 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3256489 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vps51-vamp4-1 3256474 N/A 3256490 unspecified role unspecified role prey prey Region 1-114 Region 1-114 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3256489 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false stx6-vps51-1 3256475 N/A 3256491 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Tyr40Ala Y40A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Tyr41Ala Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Leu37Ala L37A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stx10-vps51-1 3256476 N/A 3256488 unspecified role unspecified role unspecified role unspecified role Region 1-110 Region 1-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O60499-1:p.Asp5Leu D5L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O60499-1:p.Pro6Ala P6A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O60499-1:p.Phe7Leu F7L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O60499-1:p.Arg88Met R88M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vps51-vps52-5 3256477 N/A 3256492 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256489 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false vps51-stx6-1 3256478 N/A 3256491 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3256489 unspecified role unspecified role bait bait Region 1-50 Region 1-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false stx6-vps51-2 3256479 N/A 3256491 unspecified role unspecified role bait bait Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role prey prey Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false stx6-vps51-3 3256480 N/A 3256491 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role unspecified role unspecified role Region 33-49 Region 33-49 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false vps51-stx6-2 3256481 N/A 3256493 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256491 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256489 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false stx6-vps51-4 3256482 N/A 3256491 unspecified role unspecified role unspecified role unspecified role Region 3-110 Region 3-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O43752:p.Asp5Leu D5L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O43752:p.Pro6Ala P6A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O43752:p.Phe7Leu F7L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O43752:p.Arg88Met R88M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false vps51-stx10-2 3256483 N/A 3256488 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3256489 unspecified role unspecified role bait bait Region 1-50 Region 1-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vps51-stx6-3 3256484 N/A 3256492 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256493 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256491 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3256489 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Tag used for western blot detection Strep-tag Strep-tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human association association false false false stx10-vps51-2 3256485 N/A 3256488 unspecified role unspecified role unspecified role unspecified role Region 1-110 Region 1-110 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role unspecified role unspecified role Region 1-69 Region 1-69 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Tyr40Ala Y40A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Tyr41Ala Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9UID3-1:p.Leu37Ala L37A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false stx10-vps51-3 3256486 N/A 3256488 unspecified role unspecified role bait bait Region 1-232 Region 1-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3256489 unspecified role unspecified role prey prey Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9UID3-1:p.[Tyr40Ala;Tyr41Ala] Y40A/Y41A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false vps51-stx6-4 3256487 N/A 3256491 unspecified role unspecified role prey prey Region 1-103 Region 1-103 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3256489 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false