DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ xu-2013-13 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. DIP original experiment: DIP-255715X Structure (London, England : 1993) 2013 IMEx Crystal structures of Lgr4 and its complex with R-spondin1. Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. Only protein-protein interactions imex curation xu-2013-14 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. DIP original experiment: DIP-255718X Structure (London, England : 1993) 2013 IMEx Crystal structures of Lgr4 and its complex with R-spondin1. Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. Only protein-protein interactions imex curation xu-2013-15 human Homo sapiens Human dls dynamic light scattering dls predetermined predetermined participant predetermined Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. DIP original experiment: DIP-255716X Structure (London, England : 1993) 2013 IMEx Crystal structures of Lgr4 and its complex with R-spondin1. Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. Only protein-protein interactions imex curation xu-2013-16 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. DIP original experiment: DIP-255719X Structure (London, England : 1993) 2013 IMEx Crystal structures of Lgr4 and its complex with R-spondin1. Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. Only protein-protein interactions imex curation xu-2013-17 human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. DIP original experiment: DIP-255717X Structure (London, England : 1993) 2013 IMEx Crystal structures of Lgr4 and its complex with R-spondin1. Xu K., Xu Y., Rajashankar KR., Robev D., Nikolov DB. Only protein-protein interactions imex curation lgr4_xentr Leucine-rich repeat-containing G-protein coupled receptor 4 lgr4 protein protein xentr Xenopus tropicalis (Western clawed frog) Silurana tropicalis MGCPGWPLALFALLLASCSGGPSGVSSPAPCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHCFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKETLTAKDLIKLSSVSVPYAYQCCAFSACNSYMTTTVEEDRLRAQRLLLDHDRAAMDPDYMGTEDDKEHVQALIQCNPATGPFKPCEYLLGSWMIRLTVWFIFLLALIFNVIVIVTMFASCSQLTSSKLFIGLIAVSNLFMGVYTGTLTVLDTISWGQFAEFGIWWETGNGCKVAGFLAIFSSESAIFFLMLAAIERSLSAKDIIKKEKHQHLRKFQVASLLAVLLAAAAGCLPLFHIGEFSSSPLCLPFPTGETPSLGFTVTLVLLNSLAFLIMVITYTKLYCTIEKEDLSENAESSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAIYISPEIMKSVTLIFLPLPACLNPVLYVFFNPKFKEDWKLLRWRLTKRSGSVAVATNSQRGCVTQDFYYDFGMYSHLQGGNFAVCDYCESVLLKNPPPCKHLIKSHSCPTLAVVPCQRPDNYWSEFGTQSAHSDCADEEDSFVSDSSDQVQVCGRACFYQSRGLPLVRYAYNIPRMKD mint rspo1_human R-spondin-1 RSPO1 Roof plate-specific spondin-1 protein protein human Homo sapiens Human MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA lgr4-1 3256113 N/A 3256118 unspecified role unspecified role unspecified role unspecified role Region 24-455 Region 24-455 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false lgr4-rspo1-1 3256114 N/A 3256118 unspecified role unspecified role unspecified role unspecified role Region24-455 Region24-455 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3256119 unspecified role unspecified role unspecified role unspecified role Region 33-144 Region 33-144 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false lgr4-2 3256115 N/A 3256118 unspecified role unspecified role unspecified role unspecified role Region 24-455 Region 24-455 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false lgr4-rspo1-2 3256116 N/A 3256118 unspecified role unspecified role unspecified role unspecified role Region 24-455 Region 24-455 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3256119 unspecified role unspecified role unspecified role unspecified role Region 33-144 Region 33-144 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false lgr4-3 3256117 N/A 3256118 unspecified role unspecified role unspecified role unspecified role Region 24-455 Region 24-455 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false