DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nolan-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254633X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions imex curation nolan-2013-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254636X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions imex curation nolan-2013-3 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254634X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions imex curation nolan-2013-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254635X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions imex curation nolan-2013-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. DIP original experiment: DIP-254637X Structure (London, England : 1993) 2013 IMEx Structure of protein related to Dan and Cerberus: insights into the mechanism of bone morphogenetic protein antagonism. Nolan K., Kattamuri C., Luedeke DM., Deng X., Jagpal A., Zhang F., Linhardt RJ., Kenny AP., Zorn AM., Thompson TB. Only protein-protein interactions imex curation grem2_mouse Gremlin-2 Grem2 Cktsf1b2 Prdc Cysteine knot superfamily 1, BMP antagonist 2 Protein related to DAN and cerberus protein protein mouse Mus musculus Mouse MFWKLSLTLLLVAVLVKVAETRKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ bmp2_human Bone morphogenetic protein 2 BMP2 BMP2A Bone morphogenetic protein 2A protein protein human Homo sapiens Human MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR bmp4_human Bone morphogenetic protein 4 BMP4 BMP2B DVR4 Bone morphogenetic protein 2B protein protein human Homo sapiens Human MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR grem2-1 3255721 N/A 3255726 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmp2-grem2-1 3255722 N/A 3255727 unspecified role unspecified role bait bait Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3255726 unspecified role unspecified role prey prey Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O88273:p.Tyr98Ala Y98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Phe104Ala F104A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Tyr105Ala Y105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Trp72Ala W72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Phe117Ala F117A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false grem2-2 3255723 N/A 3255726 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false grem2-3 3255724 N/A 3255726 unspecified role unspecified role unspecified role unspecified role Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmp4-grem2-1 3255725 N/A 3255728 unspecified role unspecified role bait bait Region 293-408 Region 293-408 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3255726 unspecified role unspecified role prey prey Region 22-168 Region 22-168 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O88273:p.Tyr98Ala Y98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Phe104Ala F104A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Tyr105Ala Y105A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Trp72Ala W72A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O88273:p.Phe117Ala F117A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false