DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alonso-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. DIP original experiment: DIP-255705X Structure (London, England : 1993) 2013 IMEx A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4. Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. Only protein-protein interactions imex curation alonso-2013-2 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. DIP original experiment: DIP-255708X Structure (London, England : 1993) 2013 IMEx A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4. Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. Only protein-protein interactions imex curation alonso-2013-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. DIP original experiment: DIP-255706X Structure (London, England : 1993) 2013 IMEx A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4. Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. Only protein-protein interactions imex curation alonso-2013-4 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. DIP original experiment: DIP-255709X Structure (London, England : 1993) 2013 IMEx A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4. Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. Only protein-protein interactions imex curation alonso-2013-5 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. DIP original experiment: DIP-255707X Structure (London, England : 1993) 2013 IMEx A noncanonical mechanism of carboxypeptidase inhibition revealed by the crystal structure of the Tri-Kunitz SmCI in complex with human CPA4. Alonso del Rivero M., Reytor ML., Trejo SA., Chávez MA., Avilés FX., Reverter D. Only protein-protein interactions imex curation q9ui42-1 Carboxypeptidase A4 CPA4 CPA3 Carboxypeptidase A3 UNQ694/PRO1339 protein protein human Homo sapiens Human MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNLY pcpi_sabma Carboxypeptidase inhibitor SmCI protein protein sabma Sabellastarte magnifica Feather duster ISVCDLPADRGQCTAYIPQWFFNKTTEDCEKFVYGGCQGNANRFETKDDCIANCGCNLPSKVGPCRVSARMWFHNPETEKCEVFIYGGCHGNANRFATETECQEVCDRYQKPGFCYQPSETGPCKGSFPRYYYDYEDGECKEFIYGGCEGNANNFETKESCENAC cbpa1_bovin Carboxypeptidase A1 CPA1 CPA protein protein bovin Bos taurus (Bovine) Bovine MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPGSPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYATYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHSREWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTRSVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFKAFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQASGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY mint cbpa1_human Carboxypeptidase A1 CPA1 CPA protein protein human Homo sapiens Human MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY cpa4-pcpi_sabma-1 3254665 N/A 3254670 unspecified role unspecified role unspecified role unspecified role Region 114-421 Region 114-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3254671 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cpa1-pcpi_sabma-1 3254666 N/A 3254672 unspecified role unspecified role unspecified role unspecified role Region 111-419 Region 111-419 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bovin Bos taurus (Bovine) Bovine N/A 3254671 unspecified role unspecified role unspecified role unspecified role P84875:p.Ile1_Ser2del ΔIS mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cpa4-pcpi_sabma-2 3254667 N/A 3254670 unspecified role unspecified role unspecified role unspecified role Region 114-421 Region 114-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3254671 unspecified role unspecified role unspecified role unspecified role picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cpa1-pcpi_sabma-2 3254668 N/A 3254673 unspecified role unspecified role unspecified role unspecified role Region 111-419 Region 111-419 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3254671 unspecified role unspecified role unspecified role unspecified role P84875:p.Ile1_Ser2del ΔIS mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false cpa4-pcpi_sabma-3 3254669 N/A 3254670 unspecified role unspecified role unspecified role unspecified role Region 114-421 Region 114-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3254671 unspecified role unspecified role unspecified role unspecified role P84875:p.Ile1_Ser2del ΔIS mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false