DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2013-6 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. DIP original experiment: DIP-252913X Nature 2013 IMEx Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. Only protein-protein interactions imex curation zhao-2013-7 human Homo sapiens Human crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. DIP original experiment: DIP-252914X Nature 2013 IMEx Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics. Zhao G., Perilla JR., Yufenyuy EL., Meng X., Chen B., Ning J., Ahn J., Gronenborn AM., Schulten K., Aiken C., Zhang P. Only protein-protein interactions imex curation q79791_9hiv1 Gag polyprotein gag protein protein 9hiv1 Human immunodeficiency virus 1 MGARASVLSGGELDKWEKIRLRPGGKKQYRLKHIVWASRELERFAVNPGLLETSEGCRQILRQLQPSLQTGSEERRSLFNTVAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQRGNFRNQKKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ gag-17 3254525 N/A 3254527 unspecified role unspecified role unspecified role unspecified role Capsid subunit Region 133-363 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false gag-4 3254526 N/A 3254527 unspecified role unspecified role unspecified role unspecified role Capsid subunit Region 133-363 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false Q79791:p.Ala336Cys A336C mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false