DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2013-29 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang W., Kirschner MW. DIP original experiment: DIP-259893X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-30 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259887X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-31 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259895X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-32 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259891X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-33 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259892X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-34 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259889X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-35 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259894X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-36 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang W., Kirschner MW. DIP original experiment: DIP-259888X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation wang-2013-37 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang W., Kirschner MW. DIP original experiment: DIP-259890X Nature cell biology 2013 IMEx Emi1 preferentially inhibits ubiquitin chain elongation by the anaphase-promoting complex. Wang W., Kirschner MW. Only protein-protein interactions imex curation anc2_human Anaphase-promoting complex subunit 2 ANAPC2 APC2 KIAA1406 Cyclosome subunit 2 protein protein human Homo sapiens Human MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS q9ukt4-1 F-box only protein 5 FBXO5 EMI1 FBX5 Early mitotic inhibitor 1 protein protein human Homo sapiens Human MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRRL cdc23_human Cell division cycle protein 23 homolog CDC23 ANAPC8 Anaphase-promoting complex subunit 8 Cyclosome subunit 8 protein protein human Homo sapiens Human MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLRKLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP ube2s_human Ubiquitin-conjugating enzyme E2 S UBE2S E2EPF Ubiquitin-protein ligase S Ubiquitin carrier protein S Ubiquitin-conjugating enzyme E2-24 kDa Ubiquitin-conjugating enzyme E2-EPF5 OK/SW-cl.73 E2-EPF E2 ubiquitin-conjugating enzyme S protein protein human Homo sapiens Human MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF gemi_human Geminin GMNN protein protein human Homo sapiens Human MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR apc10_human Anaphase-promoting complex subunit 10 ANAPC10 APC10 Cyclosome subunit 10 protein protein human Homo sapiens Human MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR fbxo5-anapc2-1 3254447 N/A 3254456 unspecified role unspecified role prey prey in vitro In vitro N/A 3254457 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 428-447 Region 428-447 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2s-anapc2-1 3254448 N/A 3254458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254459 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 203-222 Region 203-222 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false ube2s-anapc2-2 3254449 N/A 3254457 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3254456 unspecified role unspecified role prey prey in vitro In vitro N/A 3254459 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false fbxo5-anapc2-2 3254450 N/A 3254460 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254461 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3254462 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3254458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254457 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false fbxo5-anapc2-3 3254451 N/A 3254460 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254461 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3254458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254457 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false fbxo5-anapc2-4 3254452 N/A 3254458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254457 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false ube2s-anapc2-3 3254453 N/A 3254456 unspecified role unspecified role prey prey in vitro In vitro N/A 3254459 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 203-222 Region 203-222 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ube2s-anapc2-4 3254454 N/A 3254462 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3254458 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254456 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3254459 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false fbxo5-anapc10-1 3254455 N/A 3254463 unspecified role unspecified role prey prey in vitro In vitro N/A 3254457 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false