DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rissanen-2013-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. DIP original experiment: DIP-252281X Structure (London, England : 1993) 2013 IMEx Bacteriophage P23-77 capsid protein structures reveal the archetype of an ancient branch from a major virus lineage. Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. Only protein-protein interactions imex curation rissanen-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. DIP original experiment: DIP-252278X Structure (London, England : 1993) 2013 IMEx Bacteriophage P23-77 capsid protein structures reveal the archetype of an ancient branch from a major virus lineage. Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. Only protein-protein interactions imex curation rissanen-2013-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. DIP original experiment: DIP-252282X Structure (London, England : 1993) 2013 IMEx Bacteriophage P23-77 capsid protein structures reveal the archetype of an ancient branch from a major virus lineage. Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. Only protein-protein interactions imex curation rissanen-2013-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. DIP original experiment: DIP-252279X Structure (London, England : 1993) 2013 IMEx Bacteriophage P23-77 capsid protein structures reveal the archetype of an ancient branch from a major virus lineage. Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. Only protein-protein interactions imex curation rissanen-2013-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. DIP original experiment: DIP-252280X Structure (London, England : 1993) 2013 IMEx Bacteriophage P23-77 capsid protein structures reveal the archetype of an ancient branch from a major virus lineage. Rissanen I., Grimes JM., Pawlowski A., Mäntynen S., Harlos K., Bamford JK., Stuart DI. Only protein-protein interactions imex curation c8chl4_9viru protein protein thermus thermophilus bacteriophage p23-77 thermus thermophilus bacteriophage p23-77 MQEAFNRIKALRPGARPATILRSGPEFSVYSGTQRVKVGEFVVPAGASWVLPNPVPVILKLYDTGGNQLPHTTDVFLAKRTKGFDFPEFLAKVQYASYYDLTEAQLRDAKFYQNILQTLSPLRAPQPPQGVVLREGDVLEVYVEAPAGVTVNLNDPRTRIELPIGVDNSNPTL 4E9F3F0E24465B4F c8chl5_9viru protein protein thermus thermophilus bacteriophage p23-77 thermus thermophilus bacteriophage p23-77 MGVFDRIRGALGRGLDVFRGDLPQVQPPAPQPAPAPAITPAAVQVGGWGFAWIDNEDFSPTGLAWRSGEYFALAQMKTPETAHFRIAAQERRLRIYLRGQKVVNGRNLSDPDSRTVNLPFLMQTPQGAPTLPSTYHPDVAVWAKVGSTWQPCVITAINYSTGDVTFTEPAGVTASDGIEIYYVHGDGQFRLRVARDAGGVDDSAATVFNQSFSTMHSVDQNNVETMIAWPQQVELVPGTRLVLEVFTTQVPMVWNERSGHYIQIAAMGRRIEVLDKGGLQRLAELEARGGL C6A11884936FF73D vp16-1 3253526 N/A 3253531 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false vp16-vp16-1 3253527 N/A 3253531 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253531 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vp16-vp17-1 3253528 N/A 3253532 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3253531 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false vp17-vp16-1 3253529 N/A 3253532 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3253531 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false vp16-2 3253530 N/A 3253531 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false