DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vigdorovich-2013-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Vigdorovich V., Ramagopal UA., Lázár-Molnár E., Sylvestre E., Lee JS., Hofmeyer KA., Zang X., Nathenson SG., Almo SC. DIP original experiment: DIP-252272X Structure (London, England : 1993) 2013 IMEx Structure and T cell inhibition properties of B7 family member, B7-H3. Vigdorovich V., Ramagopal UA., Lázár-Molnár E., Sylvestre E., Lee JS., Hofmeyer KA., Zang X., Nathenson SG., Almo SC. Only protein-protein interactions imex curation vigdorovich-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Vigdorovich V., Ramagopal UA., Lázár-Molnár E., Sylvestre E., Lee JS., Hofmeyer KA., Zang X., Nathenson SG., Almo SC. DIP original experiment: DIP-252273X Structure (London, England : 1993) 2013 IMEx Structure and T cell inhibition properties of B7 family member, B7-H3. Vigdorovich V., Ramagopal UA., Lázár-Molnár E., Sylvestre E., Lee JS., Hofmeyer KA., Zang X., Nathenson SG., Almo SC. Only protein-protein interactions imex curation cd276_mouse CD276 antigen Cd276 B7h3 B7 homolog 3 Costimulatory molecule protein protein mouse Mus musculus Mouse MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA cd276-1 3252854 N/A 3252856 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 34-247 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q8VE98:p.Ile126Thr I126T mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q8VE98:p.[Ile126Tyr;Gln127Gly;Asp128Gly;Phe129Ala] I126Y/Q127G/D128G/F129A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false cd276-2 3252855 N/A 3252856 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 34-247 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false