DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2013-22 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang F., Travins J., DeLaBarre B., Penard-Lacronique V., Schalm S., Hansen E., Straley K., Kernytsky A., Liu W., Gliser C., Yang H., Gross S., Artin E., Saada V., Mylonas E., Quivoron C., Popovici-Muller J., Saunders JO., Salituro FG., Yan S., Murray S., Wei W., Gao Y., Dang L., Dorsch M., Agresta S., Schenkein DP., Biller SA., Su SM., de Botton S., Yen KE. DIP original experiment: DIP-264976X Science (New York, N.Y.) 2013 IMEx Targeted inhibition of mutant IDH2 in leukemia cells induces cellular differentiation. Wang F., Travins J., DeLaBarre B., Penard-Lacronique V., Schalm S., Hansen E., Straley K., Kernytsky A., Liu W., Gliser C., Yang H., Gross S., Artin E., Saada V., Mylonas E., Quivoron C., Popovici-Muller J., Saunders JO., Salituro FG., Yan S., Murray S., Wei W., Gao Y., Dang L., Dorsch M., Agresta S., Schenkein DP., Biller SA., Su SM., de Botton S., Yen KE. Only protein-protein interactions imex curation p48735-1 Isocitrate dehydrogenase [NADP], mitochondrial IDH2 ICD-M IDP NADP(+)-specific ICDH Oxalosuccinate decarboxylase protein protein human Homo sapiens Human MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ idh2-1 3252668 N/A 3252669 unspecified role unspecified role unspecified role unspecified role Region 41-452 Region 41-452 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false