DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ junco-2013-1 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252233X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252225X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252221X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-4 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252237X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-5 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252229X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-6 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252236X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-7 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252234X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-8 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252226X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-9 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252222X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-10 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252230X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-11 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252227X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-12 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252235X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252223X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-14 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252231X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-15 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252228X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-16 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252224X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-17 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252232X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation junco-2013-18 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. DIP original experiment: DIP-252238X Structure (London, England : 1993) 2013 IMEx Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs. Junco SE., Wang R., Gaipa JC., Taylor AB., Schirf V., Gearhart MD., Bardwell VJ., Demeler B., Hart PJ., Kim CA. Only protein-protein interactions imex curation q3knv8-1 Polycomb group RING finger protein 3 PCGF3 RNF3 RNF3A RING finger protein 3A protein protein human Homo sapiens Human MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL q5h9f3-1 BCL-6 corepressor-like protein 1 BCORL1 protein protein human Homo sapiens Human MISTAPLYSGVHNWTSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPKMDYAGNVAEAEGFLVPLSSPGDGLKLPASDSAEASNSRADCSWTPLNTQMSKQVDCSPAGVKALDSRQGVGEKNTFILATLGTGVPVEGTLPLVTTNFSPLPAPICPPAPGSASVPHSVPDAFQVPLSVPAPVPHSGLVPVQVATSVPAPSPPLAPVPALAPAPPSVPTLISDSNPLSVSASVLVPVPASAPPSGPVPLSAPAPAPLSVPVSAPPLALIQAPVPPSAPTLVLAPVPTPVLAPMPASTPPAAPAPPSVPMPTPTPSSGPPSTPTLIPAFAPTPVPAPTPAPIFTPAPTPMPAATPAAIPTSAPIPASFSLSRVCFPAAQAPAMQKVPLSFQPGTVLTPSQPLVYIPPPSCGQPLSVATLPTTLGVSSTLTLPVLPSYLQDRCLPGVLASPELRSYPYAFSVARPLTSDSKLVSLEVNRLPCTSPSGSTTTQPAPDGVPGPLADTSLVTASAKVLPTPQPLLPAPSGSSAPPHPAKMPSGTEQQTEGTSVTFSPLKSPPQLEREMASPPECSEMPLDLSSKSNRQKLPLPNQRKTPPMPVLTPVHTSSKALLSTVLSRSQRTTQAAGGNVTSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKDPNLGLNRDPRHLPKQEPISIIDQGEPKGTGATCGKKGSQAGAEGQPSTVKRYTPARIAPGLPGCQTKELSLWKPTGPANIYPRCSVNGKPTSTQVLPVGWSPYHQASLLSIGISSAGQLTPSQGAPIRPTSVVSEFSGVPSLSSSEAVHGLPEGQPRPGGSFVPEQDPVTKNKTCRIAAKPYEEQVNPVLLTLSPQTGTLALSVQPSGGDIRMNQGPEESESHLCSDSTPKMEGPQGACGLKLAGDTKPKNQVLATYMSHELVLATPQNLPKMPELPLLPHDSHPKELILDVVPSSRRGSSTERPQLGSQVDLGRVKMEKVDGDVVFNLATCFRADGLPVAPQRGQAEVRAKAGQARVKQESVGVFACKNKWQPDDVTESLPPKKMKCGKEKDSEEQQLQPQAKAVVRSSHRPKCRKLPSDPQESTKKSPRGASDSGKEHNGVRGKHKHRKPTKPESQSPGKRADSHEEGSLEKKAKSSFRDFIPVVLSTRTRSQSGSICSSFAGMADSDMGSQEVFPTEEEEEVTPTPAKRRKVRKTQRDTQYRSHHAQDKSLLSQGRRHLWRAREMPWRTEAARQMWDTNEEEEEEEEEGLLKRKKRRRQKSRKYQTGEYLTEQEDEQRRKGRADLKARKQKTSSSQSLEHRLRNRNLLLPNKVQGISDSPNGFLPNNLEEPACLENSEKPSGKRKCKTKHMATVSEEAKDVVLYCLQKDSEDVNHRDNAGYTALHEACSRGWTDILNILLEHGANVNCSAQDGTRPVHDAVVNDNLETIWLLLSYGADPTLATYSGQTAMKLASSDTMKRFLSDHLSDLQGRAEGDPGVSWDFYSSSVLEEKDGFACDLLHNPPGSSDQEGDDPMEEDDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHFEITTMPKAEFYRQVASSQLLTPAERPGGLDDRSPPGSSETVELVRYEPDLLRLLGSEVEFQSCNS q9bsm1-1 Polycomb group RING finger protein 1 PCGF1 NSPC1 RNF68 Nervous system Polycomb-1 RING finger protein 68 protein protein human Homo sapiens Human MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR q6w2j9-1 BCL-6 corepressor BCOR KIAA1575 Long protein protein human Homo sapiens Human MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDASTAHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKDGSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQPPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVPTDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKPSVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPFLEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERCEYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRKRAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAKQQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLTGEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW pcgf2_human Polycomb group RING finger protein 2 PCGF2 MEL18 RNF110 ZNF144 DNA-binding protein Mel-18 RING finger protein 110 Zinc finger protein 144 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT phc1_human Polyhomeotic-like protein 1 Early development regulatory protein 1 PHC1 EDR1 PH1 protein protein human Homo sapiens Human METESEQNSNSTNGSSSSGGSSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNTSTTQQQTTTTQASINLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSGATNQSLNLSQAGGGSGNSIPGSMGPGGGGQAHGGLGQLPSSGMGGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQNVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQPQATTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLSLPPDAAPKPPIPIQSKPPVAPIKPPQLGAAKMSAAQQPPPHIPVQVVGTRQPGTAQAQALGLAQLAAAVPTSRGMPGTVQSGQAHLASSPPSSQAPGALQECPPTLAPGMTLAPVQGTAHVVKGGATTSSPVVAQVPAAFYMQSVHLPGKPQTLAVKRKADSEEERDDVSTLGSMLPAKASPVAESPKVMDEKSSLGEKAESVANVNANTPSSELVALTPAPSVPPPTLAMVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG cbx7_human Chromobox protein homolog 7 CBX7 protein protein human Homo sapiens Human MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK bcorl1-pcgf3-1 3252141 N/A 3252159 unspecified role unspecified role prey prey Region 152-242 Region 152-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252160 unspecified role unspecified role bait bait Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false pcgf1-bcorl1-1 3252142 N/A 3252160 unspecified role unspecified role prey prey Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role bait bait Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false pcgf1-bcor-7 3252143 N/A 3252162 unspecified role unspecified role prey prey Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role bait bait Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false bcor-pcgf1-5 3252144 N/A 3252162 unspecified role unspecified role bait bait Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role prey prey Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Tyr191Ala Y191A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Arg193Ala R193A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Val206Asp V206D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bcor-pcgf1-6 3252145 N/A 3252162 unspecified role unspecified role unspecified role unspecified role Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false phc1-pcgf2-3 3252146 N/A 3252163 unspecified role unspecified role prey prey Region 121-229 Region 121-229 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35227:p.Phe165Ala F165A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P35227:p.Arg164Ala R163A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P35227:p.Phe180Asp F180D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252164 unspecified role unspecified role bait bait Region 720-760 Region 720-760 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bcor-pcgf3-1 3252147 N/A 3252162 unspecified role unspecified role bait bait Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252159 unspecified role unspecified role prey prey Region 152-242 Region 152-242 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bcorl1-pcgf1-1 3252148 N/A 3252160 unspecified role unspecified role unspecified role unspecified role Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcor-pcgf1-7 3252149 N/A 3252162 unspecified role unspecified role unspecified role unspecified role Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcorl1-pcgf1-2 3252150 N/A 3252160 unspecified role unspecified role unspecified role unspecified role Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcorl1-pcgf1-3 3252151 N/A 3252160 unspecified role unspecified role unspecified role unspecified role Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false phc1-bmi1-1 3252152 N/A 3252165 unspecified role unspecified role prey prey Region 127-228 Region 127-228 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P35226:p.Tyr163Ala Y163A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P35226:p.Arg165Ala R165A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P35226:p.Phe178Asp F178D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252164 unspecified role unspecified role bait bait Region 720-760 Region 720-760 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bcor-pcgf1-8 3252153 N/A 3252162 unspecified role unspecified role unspecified role unspecified role Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcor-pcgf1-9 3252154 N/A 3252162 unspecified role unspecified role bait bait Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role prey prey Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bcorl1-pcgf1-4 3252155 N/A 3252160 unspecified role unspecified role unspecified role unspecified role Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcor-pcgf1-10 3252156 N/A 3252162 unspecified role unspecified role unspecified role unspecified role Region 1634-1748 Region 1634-1748 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role unspecified role unspecified role Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bcorl1-pcgf1-5 3252157 N/A 3252160 unspecified role unspecified role bait bait Region 1594-1711 Region 1594-1711 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252161 unspecified role unspecified role prey prey Region 167-255 Region 167-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Tyr191Ala Y191A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Arg193Ala R193A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9BSM1-1:p.Val206Asp V206D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false cbx7-rnf2-10 3252158 N/A 3252166 unspecified role unspecified role bait bait Region 211-251 Region 211-251 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3252167 unspecified role unspecified role prey prey Region 222-336 Region 222-336 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false