DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jaremko-2013-1 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Jaremko M., Jaremko Ł., Kim HY., Cho MK., Schwieters CD., Giller K., Becker S., Zweckstetter M. DIP original experiment: DIP-266887X Nature chemical biology 2013 IMEx Cold denaturation of a protein dimer monitored at atomic resolution. Jaremko M., Jaremko Ł., Kim HY., Cho MK., Schwieters CD., Giller K., Becker S., Zweckstetter M. Only protein-protein interactions imex curation q8vl32_entfl EU507_14965 cylR2 BZG32_02305 protein protein entfl Enterococcus faecalis Streptococcus faecalis MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE cylr2-1 3250719 N/A 3250720 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false