DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zanier-2013-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266849X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation zanier-2013-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266851X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation zanier-2013-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266852X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation zanier-2013-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266853X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation zanier-2013-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266850X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation zanier-2013-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. DIP original experiment: DIP-266854X Science (New York, N.Y.) 2013 IMEx Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins. Zanier K., Charbonnier S., Sidi AO., McEwen AG., Ferrario MG., Poussin-Courmontagne P., Cura V., Brimer N., Babah KO., Ansari T., Muller I., Stote RH., Cavarelli J., Vande Pol S., Travé G. Only protein-protein interactions imex curation ube3a_human Ubiquitin-protein ligase E3A E6AP ubiquitin-protein ligase Oncogenic protein-associated protein E6-AP Human papillomavirus E6-associated protein Renal carcinoma antigen NY-REN-54 UBE3A E6AP EPVE6AP HPVE6A HECT-type ubiquitin transferase E3A protein protein human Homo sapiens Human MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML ve6_hpv16 Protein E6 E6 protein protein hpv16 Human papillomavirus type 16 MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL ptn3_human Tyrosine-protein phosphatase non-receptor type 3 Protein-tyrosine phosphatase H1 PTPN3 PTPH1 protein protein human Homo sapiens Human MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLAPQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQMLDPS ve6_bpv1 Protein E6 E6 protein protein bpv1 Bovine papillomavirus type 1 MDLKPFARTNPFSGLDCLWCREPLTEVDAFRCMVKDFHVVIREGCRYGACTICLENCLATERRLWQGVPVTGEEAELLHGKTLDRLCIRCCYCGGKLTKNEKHRHVLFNEPFCKTRANIIRGRCYDCCRHGSRSKYP mint Transcriptional transactivator. Binds double stranded DNA paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC e6-ube3a-10 3250473 N/A 3250479 unspecified role unspecified role unspecified role unspecified role Region 403-414 Region 403-414 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3250480 unspecified role unspecified role unspecified role unspecified role Region 9-150 Region 9-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false e6-ube3a-11 3250474 N/A 3250479 unspecified role unspecified role prey prey Region 401-418 Region 401-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3250480 unspecified role unspecified role bait bait P03126:p.Leu57Ala L50A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg109Ala R102A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg138Ala R131A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg17Ala R10A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg62Ala R55A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Ser78Arg S71A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false e6-ptpn3-4 3250475 N/A 3250481 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3250480 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pxn-e6-3 3250476 N/A 3250482 unspecified role unspecified role prey prey P06931:p.Leu58Ser L58S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg89Ala R89A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg89Leu R89L mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg116Gly R116/G/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg121Gly R121G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Phe37Ser F37S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P06931:p.Arg116Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3250483 unspecified role unspecified role bait bait Region 1-11 Region 1-11 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false e6-pxn-6 3250477 N/A 3250482 unspecified role unspecified role bait bait P06931:p.Phe37Ser F37S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Leu58Ser L58S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg89Ala R89A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg89Leu R89L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg116Gly R116/G/D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg121Gly R121G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P06931:p.Arg116Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3250483 unspecified role unspecified role prey prey Region 1-11 Region 1-11 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ube3a-e6-8 3250478 N/A 3250479 unspecified role unspecified role bait bait Region 401-418 Region 401-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3250480 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P03126:p.Leu57Glu L50E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg62Ala R55A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg138Ala R131A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P03126:p.Arg109Ala R102A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false