DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hanazono-2013-1 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. DIP original experiment: DIP-251909X Structure (London, England : 1993) 2013 IMEx Nonequivalence observed for the 16-meric structure of a small heat shock protein, SpHsp16.0, from Schizosaccharomyces pombe. Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. Only protein-protein interactions imex curation hanazono-2013-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. DIP original experiment: DIP-251910X Structure (London, England : 1993) 2013 IMEx Nonequivalence observed for the 16-meric structure of a small heat shock protein, SpHsp16.0, from Schizosaccharomyces pombe. Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. Only protein-protein interactions imex curation hanazono-2013-3 ecolx Escherichia coli filter trap assay filter trap assay Filter retention assay Filter retention assay predetermined predetermined participant predetermined Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. DIP original experiment: DIP-251911X Structure (London, England : 1993) 2013 IMEx Nonequivalence observed for the 16-meric structure of a small heat shock protein, SpHsp16.0, from Schizosaccharomyces pombe. Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. Only protein-protein interactions imex curation hanazono-2013-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. DIP original experiment: DIP-251912X Structure (London, England : 1993) 2013 IMEx Nonequivalence observed for the 16-meric structure of a small heat shock protein, SpHsp16.0, from Schizosaccharomyces pombe. Hanazono Y., Takeda K., Oka T., Abe T., Tomonari T., Akiyama N., Aikawa Y., Yohda M., Miki K. Only protein-protein interactions imex curation hsp16_schpo Heat shock protein 16 hsp16 16 kDa heat shock protein SPBC3E7.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLQPFFGFPPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK 321D474116FCE380 sphsp16-1 3249174 N/A 3249178 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sphsp16-2 3249175 N/A 3249178 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sphsp16-3 3249176 N/A 3249178 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sphsp16-4 3249177 N/A 3249178 unspecified role unspecified role unspecified role unspecified role O14368:p.Phe6Ala F6A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O14368:p.Phe7Ala F7A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false