DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alonzo-2013-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. DIP original experiment: DIP-252026X Nature 2013 IMEx CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. Only protein-protein interactions imex curation alonzo-2013-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. DIP original experiment: DIP-252027X Nature 2013 IMEx CCR5 is a receptor for Staphylococcus aureus leukotoxin ED. Alonzo F., Kozhaya L., Rawlings SA., Reyes-Robles T., DuMont AL., Myszka DG., Landau NR., Unutmaz D., Torres VJ. Only protein-protein interactions imex curation ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL luke_staau Leucotoxin LukE lukE protein protein staau Staphylococcus aureus MFKKKMLAASLSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQFDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGRGYELTKRLIWPFQYNIGLTTKDPNVSLINSITLPKTKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQNSKSVKWGVKANKFVTPDGKKFAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPSFITTLSHEKGSKLIRVNLKFSYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYKVNWKTHEIKVKGHN luke-ccr5-1 3248419 N/A 3248421 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3248422 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Mature protein Region 29-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ccr5-luke-1 3248420 N/A 3248421 unspecified role unspecified role bait bait canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris N/A 3248422 unspecified role unspecified role prey prey Mature protein Region 29-314 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false