DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ma-2012-19 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Ma J., Edlich F., Bermejo GA., Norris KL., Youle RJ., Tjandra N. DIP original experiment: DIP-251860X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural mechanism of Bax inhibition by cytomegalovirus protein vMIA. Ma J., Edlich F., Bermejo GA., Norris KL., Youle RJ., Tjandra N. Only protein-protein interactions imex curation ma-2012-20 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Ma J., Edlich F., Bermejo GA., Norris KL., Youle RJ., Tjandra N. DIP original experiment: DIP-251861X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural mechanism of Bax inhibition by cytomegalovirus protein vMIA. Ma J., Edlich F., Bermejo GA., Norris KL., Youle RJ., Tjandra N. Only protein-protein interactions imex curation vgli_hcmva UL37 immediate early glycoprotein UL37 protein protein hcmva Human cytomegalovirus (strain AD169) (HHV-5) Human herpesvirus 5 HHV-5 MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEEREDEEEENEARTPEVNPIDAEGLSGLAREACEALKKALRRHRFLWQRRQRARMLQHNGPQQSHHAAVFCRVHGLRGFQVSVWLLLTLLWSTGHGVSVRCTYHGTDVNRTSNTTSMNCHLNCTRNHTQIYNGPCLGTEARLPLNVTFNQSRRKWHSVMLKFGFQYHLEGWFPLRVLNESREINVTEVHGEVACFRNDTNVTVGQLTLNFTGHSYVLRAIAHTSPFESYVRWEETNVTDNATSSENTTTVMSTLTKYAESDYIFLQDMCPRFLKRTVKLTRNKTKHNVTVTGNNMTTLPVWTPECKGWTYWTTLSVMWRNRRSALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHRIV bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bax-ul37-1 3248161 N/A 3248163 unspecified role unspecified role unspecified role unspecified role Region 130-150 Region 130-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3248164 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bax-ul37-2 3248162 N/A 3248163 unspecified role unspecified role unspecified role unspecified role Region 130-150 Region 130-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P16778:p.Leu143Ala L143A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P16778:p.Arg139Glu R139E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P16778:p.Arg146Glu R146E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false BODIPY-label BODIPY-label bodipy label bodipy label certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3248164 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false