DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ woo-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251440X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions imex curation woo-2012-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251443X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions imex curation woo-2012-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251441X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions imex curation woo-2012-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Woo JS., Zeltina A., Goetz BA., Locher KP. DIP original experiment: DIP-251442X Nature structural & molecular biology 2012 IMEx X-ray structure of the Yersinia pestis heme transporter HmuUV. Woo JS., Zeltina A., Goetz BA., Locher KP. Only protein-protein interactions imex curation hmuv_yerpe Hemin import ATP-binding protein HmuV hmuV YPO0279 y0539 YP_0434 protein protein yerpe Yersinia pestis MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ hmuu_yerpe Hemin transport system permease protein HmuU hmuU YPO0280 y0540 YP_0435 protein protein yerpe Yersinia pestis MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTNDAMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLIIVMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGDEEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLPGAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG hmut_yerpe Hemin-binding periplasmic protein HmuT hmuT YPO0281 y0541 YP_0436 protein protein yerpe Yersinia pestis MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGAGDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIASSGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLFVMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDGVKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ hmuu-hmuv-1 3247318 N/A 3247322 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247323 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hmuu-hmuv-2 3247319 N/A 3247322 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247323 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false hmuu-hmuv-3 3247320 N/A 3247322 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247323 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hmut-hmuu-1 3247321 N/A 3247324 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247322 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247323 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false