DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ liu-2012-31 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251425X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-32 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251416X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-33 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251427X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-34 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251418X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-35 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251422X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-36 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251420X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-37 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251417X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-38 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251426X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-39 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251419X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-40 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251423X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-41 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251424X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation liu-2012-42 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. DIP original experiment: DIP-251421X Nature structural & molecular biology 2012 IMEx Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX. Liu CP., Xiong C., Wang M., Yu Z., Yang N., Chen P., Zhang Z., Li G., Xu RM. Only protein-protein interactions imex curation h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA q9uer7-1 Death domain-associated protein 6 DAXX BING2 DAP6 Daxx ETS1-associated protein 1 Fas death domain-associated protein protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA daxx-hist1h3a-1 3247123 N/A 3247135 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.[Glu225Met;Lys229Met] E225M/K229M mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-3 3247124 N/A 3247137 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247138 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247136 unspecified role unspecified role unspecified role unspecified role Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false daxx-hist1h3a-2 3247125 N/A 3247135 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247137 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247136 unspecified role unspecified role bait bait Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.[Glu225Met;Lys229Met] E225M/K229M mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false daxx-h3f3a-4 3247126 N/A 3247137 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247138 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247136 unspecified role unspecified role bait bait Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false hist1h3a-daxx-1 3247127 N/A 3247135 unspecified role unspecified role bait bait P68431:p.Ser88Ala S88A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false h3f3a-daxx-1 3247128 N/A 3247138 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-5 3247129 N/A 3247137 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247138 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3247136 unspecified role unspecified role unspecified role unspecified role Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hist1h3a-daxx-2 3247130 N/A 3247135 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.[Glu225Met;Lys229Met] E225M/K229M mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-13 3247131 N/A 3247138 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false daxx-h3f3a-14 3247132 N/A 3247137 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247138 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247136 unspecified role unspecified role bait bait Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UER7-1:p.Tyr222Glu Y222E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli association association false false false daxx-hist1h3a-3 3247133 N/A 3247135 unspecified role unspecified role prey prey P68431:p.Ser88Ala S88A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3247137 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3247136 unspecified role unspecified role bait bait Region 184-390 Region 184-390 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false daxx-hist1h3a-4 3247134 N/A 3247135 unspecified role unspecified role prey prey P68431:p.Ser88Ala S88A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3247136 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false